KEGG   Bacteroides helcogenes: Bache_1091Help
Entry
Bache_1091        CDS       T01393                                 

Definition
glutamate formiminotransferase (EC:2.1.2.5)
Orthology
K00603  
glutamate formiminotransferase [EC:2.1.2.5]
Organism
bhl  Bacteroides helcogenes
Pathway
Histidine metabolism
One carbon pool by folate
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bhl00340]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bhl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1377118..1378014
Genome map
AA seq 298 aa AA seqDB search
MNRIIECVPNFSEGRDLQKIDEIVAPFRARQGVKLLDYSNDEDHNRLVVTVVGEPEPLRE
AVLEAIGVAVRLIDLNTHKGQHPRMGAVDVVPFIPIKNVTMEEAIALSKEVAGEVAKRYN
LPVFLYEKSASAPYRENLAAIRKGEFEGMGEKIKQPEWHPDFGPAEKHPTAGTVAIGARM
PLVAYNVNLSTPNLEIAHDIAKKIRFIGGGLRYCKAMGVELKDRGITQVSINMTDFTHTA
LYRAFELVRIEARRYGVSIVGSEIIGLVPMEALIDTASYYLGLENFSMQQVLEARIME
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattattgagtgcgttcctaacttcagcgaaggacgtgacctgcaaaagata
gacgagatagtagctcctttccgtgcccgtcaaggcgtgaaattgcttgattatagtaat
gatgaagaccacaatcgtttggtggttactgttgtgggcgagcccgaaccgcttcgcgaa
gcagtgctcgaagctatcggcgtagcagtccgccttattgacctcaatacccataaggga
cagcacccacgtatgggagcagtggatgtagtgccttttattcctatcaagaatgtaacg
atggaagaagccatcgccctttctaaagaggtagccggggaagtggcaaaacgttataat
ctccccgtcttcttgtacgagaaatctgcttccgcaccgtatcgcgaaaaccttgcagcc
atccgcaagggtgaattcgaaggaatgggagaaaagataaaacaaccggaatggcacccc
gatttcggtcccgccgagaagcatcctactgctggtacggtagccatcggtgcccgtatg
cctttggtagcttataatgtcaacctcagtactcctaatctggagatagctcacgatata
gctaagaagatccgtttcatcggcggcggtttgcgttattgcaaggctatgggggtggaa
ctgaaagaccggggaattacccaagtctccattaacatgacggactttacacatacagcc
ctttaccgtgctttcgaattggttcgcattgaagcccgccgttacggagtgagcattgtg
gggagtgaaatcatcggacttgtacctatggaagcgctgattgatactgcatcctattac
ttgggcttggaaaacttttctatgcagcaagtgttggaagcaagaattatggagtag

DBGET integrated database retrieval system