KEGG   Bacteroides helcogenes: Bache_1166Help
Entry
Bache_1166        CDS       T01393                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bhl  Bacteroides helcogenes
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bache_1166
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bache_1166
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bache_1166
Enzymes [BR:bhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bache_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1485139..1486440
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQAPEATLEEAVVRGLAADKGLFMPFTIKPLPQEFYDSIDTLSFQEIAYRVAD
AFFGEDVPADVLKQIVYDTLSFDIPLVQVTENIYSLELFHGPTLAFKDVGGRFMARLLGY
FIRKEGKKQVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGQNI
TALEIDGTFDDCQALVKAAFMDGELNEHLQLTSANSINVARFLPQAFYYFYAYAQLKRAG
KADNAVICVPSGNFGNITAGLFGKRMGLPVKRFIASNNRNDIFYQYLQTGVYSPRPSIAT
IANAMDVGDPSNFARVLDLYGGSHADISAEISGTTYTDEQIAETMKKVWKEDHYLLDPHG
ACGFRALVEGLHPGETGVFLETAHPAKFKDTVEKIIGEAVEIPEKLQAFMRGEKKSLSMS
KDFADFKQYLMSL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactatagtaccaacaaacaagcccccgaagctacccttgaagaagcggtagta
cgcggacttgccgcagacaaaggacttttcatgccctttaccatcaaaccgttgccgcag
gagttctacgacagcatcgacacactcagttttcaggaaatagcctaccgggtagccgat
gctttctttggagaagatgttccggctgatgtgctgaaacagattgtgtatgatacgttg
agtttcgacattcctttggtacaggttacagagaatatttattccttggaactgttccac
ggtcctacgcttgcctttaaggatgtgggtggtcgctttatggctcgtctactgggctac
ttcatccgcaaagaagggaaaaagcaggtgaatgtactggtagccacttccggtgatacg
ggaagtgccgtagctaatggctttctgggtgtggaaggtattcatgtatatgtgctttat
ccgaaaggcaaagtcagcgaaatacaagaaaaacagttcactactttagggcagaacatt
accgccctcgaaatagatggtacatttgatgattgccaagctttggtaaaagccgctttc
atggacggagaactcaacgagcacttgcaactgaccagtgccaattccatcaatgtagcc
cgattcctgccgcaagcattctattacttctatgcatacgcacagttgaagcgtgcaggc
aaagcagacaatgctgttatctgtgtacccagtggtaacttcggtaacattacagccgga
ctttttggcaagcgcatgggacttccggtgaaacgctttatcgcttccaataaccgtaat
gatatattctaccaatatttgcagacgggtgtttactcgccccgtcccagcattgctacc
attgccaatgctatggatgtaggcgatccgagtaactttgcccgcgtgctcgacctttat
ggaggcagtcatgctgacatttctgccgaaatcagcggtactacttataccgacgagcag
attgccgaaaccatgaaaaaggtttggaaagaagaccattacctgctcgatcctcatgga
gcatgtggtttccgtgccttagtagaaggacttcatcccggcgagacgggtgttttcctg
gaaacggcacatccggctaagttcaaggatacggtagagaagattatcggcgaagcagta
gagataccggaaaaactgcaagcctttatgcggggcgagaagaaaagcttgtcgatgtcg
aaagactttgcagacttcaaacaatatctgatgagtttataa

DBGET integrated database retrieval system