KEGG   Bacteroides helcogenes: Bache_1166Help
Entry
Bache_1166        CDS       T01393                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bhl  Bacteroides helcogenes
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bache_1166
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bache_1166
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bache_1166
Enzymes [BR:bhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bache_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1485139..1486440
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQAPEATLEEAVVRGLAADKGLFMPFTIKPLPQEFYDSIDTLSFQEIAYRVAD
AFFGEDVPADVLKQIVYDTLSFDIPLVQVTENIYSLELFHGPTLAFKDVGGRFMARLLGY
FIRKEGKKQVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGQNI
TALEIDGTFDDCQALVKAAFMDGELNEHLQLTSANSINVARFLPQAFYYFYAYAQLKRAG
KADNAVICVPSGNFGNITAGLFGKRMGLPVKRFIASNNRNDIFYQYLQTGVYSPRPSIAT
IANAMDVGDPSNFARVLDLYGGSHADISAEISGTTYTDEQIAETMKKVWKEDHYLLDPHG
ACGFRALVEGLHPGETGVFLETAHPAKFKDTVEKIIGEAVEIPEKLQAFMRGEKKSLSMS
KDFADFKQYLMSL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactatagtaccaacaaacaagcccccgaagctacccttgaagaagcggtagta
cgcggacttgccgcagacaaaggacttttcatgccctttaccatcaaaccgttgccgcag
gagttctacgacagcatcgacacactcagttttcaggaaatagcctaccgggtagccgat
gctttctttggagaagatgttccggctgatgtgctgaaacagattgtgtatgatacgttg
agtttcgacattcctttggtacaggttacagagaatatttattccttggaactgttccac
ggtcctacgcttgcctttaaggatgtgggtggtcgctttatggctcgtctactgggctac
ttcatccgcaaagaagggaaaaagcaggtgaatgtactggtagccacttccggtgatacg
ggaagtgccgtagctaatggctttctgggtgtggaaggtattcatgtatatgtgctttat
ccgaaaggcaaagtcagcgaaatacaagaaaaacagttcactactttagggcagaacatt
accgccctcgaaatagatggtacatttgatgattgccaagctttggtaaaagccgctttc
atggacggagaactcaacgagcacttgcaactgaccagtgccaattccatcaatgtagcc
cgattcctgccgcaagcattctattacttctatgcatacgcacagttgaagcgtgcaggc
aaagcagacaatgctgttatctgtgtacccagtggtaacttcggtaacattacagccgga
ctttttggcaagcgcatgggacttccggtgaaacgctttatcgcttccaataaccgtaat
gatatattctaccaatatttgcagacgggtgtttactcgccccgtcccagcattgctacc
attgccaatgctatggatgtaggcgatccgagtaactttgcccgcgtgctcgacctttat
ggaggcagtcatgctgacatttctgccgaaatcagcggtactacttataccgacgagcag
attgccgaaaccatgaaaaaggtttggaaagaagaccattacctgctcgatcctcatgga
gcatgtggtttccgtgccttagtagaaggacttcatcccggcgagacgggtgttttcctg
gaaacggcacatccggctaagttcaaggatacggtagagaagattatcggcgaagcagta
gagataccggaaaaactgcaagcctttatgcggggcgagaagaaaagcttgtcgatgtcg
aaagactttgcagacttcaaacaatatctgatgagtttataa

DBGET integrated database retrieval system