KEGG   Bacteroides helcogenes: Bache_1619Help
Entry
Bache_1619        CDS       T01393                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bhl  Bacteroides helcogenes
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bache_1619
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_1619
   00052 Galactose metabolism
    Bache_1619
   00500 Starch and sucrose metabolism
    Bache_1619
   00520 Amino sugar and nucleotide sugar metabolism
    Bache_1619
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bache_1619
   00524 Butirosin and neomycin biosynthesis
    Bache_1619
Enzymes [BR:bhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bache_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2035115..2036044
Genome map
AA seq 309 aa AA seqDB search
MKYAIGIDLGGTSIKYALVDKAGNSFFEGKLPSFASVSAAKVMEQLIKAATLLKDEAAKQ
NWTVLGIGLGTPGIVDETNRIVLGGAENIVGWENIDVASLMEKQMSLPVVVGNDANLMGL
GETKYGAGRGCTHVVFLTVGTGIGGAVIIDGKLFNGYANRGTELGHVPLIANGERCACGA
IGCLEHYASTAALTRRFSALAKEQKLSFDTEINGELIVRLYHENFPLAVECMNEHFYYLG
RGIAGFVNIFSPQRIVIGGGVAESGSFYLEKIRAVVKKHVIADCALDTKIVAAELGNKAG
LIGAASLIL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgcaattggcattgatttaggtggcacatctataaaatatgctttggtagat
aaagcgggtaattctttctttgaggggaaattaccctcttttgcttctgtctcggctgca
aaagtgatggaacaactgataaaggctgccaccttgctgaaagatgaagccgcaaaacag
aactggaccgtactgggtatagggctcggtacaccgggaattgtagatgaaacaaaccgt
atcgtactgggaggtgcggaaaatattgtcggctgggaaaacatagatgtagcctccctt
atggagaaacagatgagtttaccggtagttgttggaaatgatgccaatctgatgggactg
ggagaaacgaaatatggtgcaggaagaggttgcactcatgtggtgtttctgactgtagga
accggtatcggcggagctgtcatcattgatggtaaattgttcaatggatatgctaaccgg
ggtacggagttggggcatgtaccgttgattgccaacggtgaacgttgtgcctgcggggca
atcggctgcctggaacattatgcttcgactgccgccttgacaagacgtttcagcgcattg
gcgaaagagcagaaattaagttttgatacggagataaacggggaattgattgttcgcctg
tatcatgaaaatttcccgctcgctgtcgagtgcatgaacgaacacttttactatttgggc
agaggaattgccggctttgtcaatatcttcagtccccaacggattgtgataggaggaggt
gttgcagaatccggcagtttctatttagagaaaataagggcggtagtcaaaaagcacgta
atagcagactgtgccctggataccaagattgtagcagccgaattgggcaataaagccggt
cttatcggtgcagcatcactaattctataa

DBGET integrated database retrieval system