KEGG   Bacteroides helcogenes: Bache_1768Help
Entry
Bache_1768        CDS       T01393                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00260  Glycine, serine and threonine metabolism
bhl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bhl01100  Metabolic pathways
bhl01110  Biosynthesis of secondary metabolites
bhl01130  Biosynthesis of antibiotics
bhl01230  Biosynthesis of amino acids
Module
bhl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bache_1768
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bache_1768
Enzymes [BR:bhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bache_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP IES5
Motif
Other DBs
NCBI-ProteinID: ADV43753
UniProt: E6SNK4
Position
complement(2210283..2211650)
Genome map
AA seq 455 aa AA seqDB search
MSNKTKRFILPEDEIPRYWYNIQADMVNKPMPPLHPGTKQPLKAEDLYPIFAEELCRQEL
NQTDAWIEIPEEVRDMYKYYRSTPLVRAYGLEKALGTPAHIYFKNESVSPMGSHKLNSAI
PQAYYCKKEGVTNVTTETGAGQWGASLAYAARLFGLEAAVYQVKISYEQKPYRRSVMQTF
GAQVTPSPSMSTRAGKDILTAHPNHQGSLGTAISEAIELAQNTPNCKYTLGSVLSHVTLH
QTVIGLEAEKQMAMAGEYPDVVIACFGGGSNFGGISFPFMRHKILEGKKTRFVAAEPASC
PKLTRGKFQYDFGDEAGYTPLLPMFTLGHNFAPANIHAGGLRYHGAGVIVSQLLKDGLME
AVDIKQLESFDAGVLFAQAEGIIPAPESCHAIAAAVREANACKETGEEKVILFNLSGHGL
IDMASYDKYLSGDLVNYELTDKDIQENLDEIGNLA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaagacaaaaagatttattctcccggaagatgaaattccacgttattggtat
aacatacaggccgatatggtgaacaaacccatgccaccgcttcaccccggcactaaacaa
cccctgaaagccgaagatttatatcctatctttgccgaagaactctgccgccaggaattg
aaccagacagatgcctggattgaaattcccgaagaagtgcgcgacatgtacaaatattac
cgcagcactcctctggtgcgtgcctatgggctggaaaaagcactcggcactccggcacat
atctacttcaagaacgagagcgtcagccctatggggtcacacaagctcaattcggccata
ccgcaggcatattactgcaagaaggagggagttaccaacgtcaccaccgaaaccggagcc
ggacaatggggtgcttctttggcctatgccgcacgccttttcggactggaagccgccgtt
tatcaggtgaaaatcagttatgaacagaagccctaccgacgcagtgtgatgcagacgttc
ggtgcacaggtcactccttcaccctccatgtccacccgtgccggaaaagacatcctgacc
gcgcaccccaatcatcagggttcattgggcacagccatatccgaggctatcgaactggca
caaaacactcctaactgcaaatataccctcggctccgtgctgagccatgtgacgttgcat
caaaccgttatcgggcttgaagctgaaaagcaaatggccatggcaggcgagtatccggat
gtggtgatagcatgcttcggcggcggctccaacttcggcggtatttctttccccttcatg
cgccataaaatccttgaagggaaaaagacacgctttgttgccgccgaacctgcctcgtgc
ccgaaactgacgcgcggcaaattccagtacgatttcggtgatgaagccggatatacgcca
ttgctgcccatgtttacattgggacacaattttgcgccggccaatatacacgccggtggt
ctgcgctatcatggcgcaggtgtcattgtctcgcaattgctgaaagacggcctgatggaa
gctgtggacatcaagcaactggaatcattcgacgcaggagttctgtttgcacaggcagaa
ggcatcatcccagcgcccgaatcgtgccatgccattgcggcggctgtgcgcgaggcaaac
gcatgcaaagaaaccggtgaggaaaaggtaatcttgttcaacctatccggacacgggctt
atcgatatggcatcgtatgacaagtatctatccggcgacttggtgaactatgaattgacc
gacaaggacattcaggaaaatctggatgaaatcgggaatctggcctga

DBGET integrated database retrieval system