KEGG   Bacteroides helcogenes: Bache_1967Help
Entry
Bache_1967        CDS       T01393                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bhl  Bacteroides helcogenes
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Bache_1967
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bache_1967
Enzymes [BR:bhl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Bache_1967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2421866..2422297
Genome map
AA seq 143 aa AA seqDB search
MIEGVSLFPLKHIVVSKGDIYHAMKSTDEGYVGFGEAYFSHIEHGQAKGWKRHNRMTLNL
IVPVGAVKFVVYDDRDGSETKGKFEEFIISPETNYQRLTVAPGIWMAFYGVGEGTSILMD
IIPEPHDPDEASRKDLSEINYSF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaggtgtatcgctttttcctttgaagcacatagtggtgtccaaaggggatatt
tatcatgcaatgaaatctacggatgaggggtatgtgggatttggagaagcttatttttcg
cacatagagcatgggcaggcaaaaggttggaaacgccataatcgtatgacgctaaatttg
attgttccggtaggtgcggtgaaatttgttgtctatgatgaccgtgacggaagtgagacc
aaaggcaagttcgaagaatttattatttcacctgaaacaaactatcaacgtcttactgta
gctcctggaatatggatggctttttatggagtgggagagggaacatctatcttaatggat
attattccagaacctcatgaccctgatgaagcaagcagaaaagatttgtcggaaattaat
tattctttttaa

DBGET integrated database retrieval system