KEGG   Bacteroides helcogenes: Bache_2023Help
Entry
Bache_2023        CDS       T01393                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bhl  Bacteroides helcogenes
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bache_2023
   01230 Biosynthesis of amino acids
    Bache_2023
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_2023
  Energy metabolism
   00680 Methane metabolism
    Bache_2023
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bache_2023
Enzymes [BR:bhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bache_2023
Exosome [BR:bhl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bache_2023
  Exosomal proteins of melanoma cells
   Bache_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2481713..2482459
Genome map
AA seq 248 aa AA seqDB search
MKRIVLLRHGESAWNRENRFTGWTDVDLTEKGVAEAVRVGELLKEKGFHFKRAYTSYLKR
AVKTLDCVLDRLDQDWIPVEKSWRLNEKHYGELQGLNKAETAAKYGDEQVLVWRRSYDIA
PHALAEDDSRNPRFEDRYQAVPDAELPRTESLKDTIERIMPYWKCVIFPSLSTAGELLVV
AHGNSLRGIIKHLKHIPDDEIVHLNLPTAVPYVFEFDDALNLTGDYFLGDPEEIRKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattgttttgctgcgccacggtgagagtgcatggaacagggaaaaccgtttt
acgggttggaccgatgtcgatttaaccgagaaaggcgttgccgaggccgtaagggtcggt
gagttgctgaaagaaaaaggatttcacttcaagagggcttatacatcctacttgaaacgt
gccgtgaagacattggattgcgtacttgaccgtttggatcaggactggattcccgtagag
aaatcctggcggctgaacgaaaagcattacggtgagttgcaaggtctcaacaaggccgaa
accgccgccaaatatggtgacgagcaggtgctggtgtggcgcagaagctacgatatcgcc
cctcatgcattggctgaggatgattcgcgtaatccccgctttgaagaccgctatcaggca
gtgcccgatgcggagctgccccggaccgaatcattgaaagataccattgagcgcattatg
ccatattggaaatgtgtcattttcccgagcctgagtacggccggtgaattgttggtagtg
gcgcatggcaatagcctgcggggcattatcaagcacttgaagcatattccggatgatgag
atcgtgcatctgaaccttccaacggcagtgccttatgtttttgagtttgatgacgcgctg
aatctgaccggtgattatttcctgggagatccggaagaaatcaggaagctgatggaagcg
gtggccaaccaaggaaaaaagaagtaa

DBGET integrated database retrieval system