KEGG   Bacteroides helcogenes: Bache_2058Help
Entry
Bache_2058        CDS       T01393                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00260  Glycine, serine and threonine metabolism
bhl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bhl01100  Metabolic pathways
bhl01110  Biosynthesis of secondary metabolites
bhl01130  Biosynthesis of antibiotics
bhl01230  Biosynthesis of amino acids
Module
bhl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bache_2058
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bache_2058
Enzymes [BR:bhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bache_2058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA WD40_3 DMRL_synthase
Motif
Other DBs
NCBI-ProteinID: ADV44029
UniProt: E6SQU6
Position
complement(2519891..2520667)
Genome map
AA seq 258 aa AA seqDB search
MNRINQLFQDSPKNLLSIYFCAGCPTLKGTADVIRTLEKNGVNMIEIGIPFSDPMADGIV
IQNAATRALRNGMSLRLLFEQLQDIRHDVCIPLILMGYLNPIMQFGFEAFCRKCTECGID
GVIIPDLPFKDYEASYKAIARKHDIRVIMLITPETSEARVREIDAHTDGFVYMVSSAATT
GAQTDFDVRKQAYFKKIEDMRLRNPRMVGFGISNRQTFEAACAHASGAIIGSRFVTLLNE
TDGDAEKAIGILKEDLKK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtattaaccaactttttcaggacagccccaaaaatctgctgtccatctatttc
tgcgcaggctgccccaccctcaaaggcactgccgacgtaatccgtaccctcgaaaaaaac
ggggtaaacatgatagagatcggcatcccgttcagcgacccgatggccgacggcattgtc
atccaaaacgccgccacccgcgccctccggaacggcatgtccctccgcctccttttcgaa
caactgcaagacatccgccatgacgtctgcattccacttatcctcatgggctacctcaac
cccatcatgcagtttggattcgaagccttctgccggaagtgcacggaatgcggcatcgac
ggcgtcatcattcccgacctccccttcaaggattacgaggcaagctataaagctattgcc
cggaagcatgacatccgcgtcatcatgctcatcactcccgaaaccagcgaggcgcgcgta
cgcgagatcgacgcacatacggacggattcgtctatatggtttccagtgctgctaccacc
ggcgcccagaccgatttcgacgtccgcaagcaagcctacttcaaaaaaatagaagacatg
cgcctgcgcaatccccgcatggtggggttcggcatcagcaacaggcagacctttgaagcg
gcctgcgcccatgcctccggcgccatcataggcagccgcttcgtcactctgctgaacgaa
accgacggagacgcggagaaggccatcggaatactgaaagaagatctcaagaagtag

DBGET integrated database retrieval system