KEGG   Bacteroides helcogenes: Bache_2058Help
Entry
Bache_2058        CDS       T01393                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bhl  Bacteroides helcogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bache_2058
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bache_2058
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bache_2058
Enzymes [BR:bhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bache_2058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2519891..2520667)
Genome map
AA seq 258 aa AA seqDB search
MNRINQLFQDSPKNLLSIYFCAGCPTLKGTADVIRTLEKNGVNMIEIGIPFSDPMADGIV
IQNAATRALRNGMSLRLLFEQLQDIRHDVCIPLILMGYLNPIMQFGFEAFCRKCTECGID
GVIIPDLPFKDYEASYKAIARKHDIRVIMLITPETSEARVREIDAHTDGFVYMVSSAATT
GAQTDFDVRKQAYFKKIEDMRLRNPRMVGFGISNRQTFEAACAHASGAIIGSRFVTLLNE
TDGDAEKAIGILKEDLKK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtattaaccaactttttcaggacagccccaaaaatctgctgtccatctatttc
tgcgcaggctgccccaccctcaaaggcactgccgacgtaatccgtaccctcgaaaaaaac
ggggtaaacatgatagagatcggcatcccgttcagcgacccgatggccgacggcattgtc
atccaaaacgccgccacccgcgccctccggaacggcatgtccctccgcctccttttcgaa
caactgcaagacatccgccatgacgtctgcattccacttatcctcatgggctacctcaac
cccatcatgcagtttggattcgaagccttctgccggaagtgcacggaatgcggcatcgac
ggcgtcatcattcccgacctccccttcaaggattacgaggcaagctataaagctattgcc
cggaagcatgacatccgcgtcatcatgctcatcactcccgaaaccagcgaggcgcgcgta
cgcgagatcgacgcacatacggacggattcgtctatatggtttccagtgctgctaccacc
ggcgcccagaccgatttcgacgtccgcaagcaagcctacttcaaaaaaatagaagacatg
cgcctgcgcaatccccgcatggtggggttcggcatcagcaacaggcagacctttgaagcg
gcctgcgcccatgcctccggcgccatcataggcagccgcttcgtcactctgctgaacgaa
accgacggagacgcggagaaggccatcggaatactgaaagaagatctcaagaagtag

DBGET integrated database retrieval system