KEGG   Bacteroides helcogenes: Bache_2355Help
Entry
Bache_2355        CDS       T01393                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bhl  Bacteroides helcogenes
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bache_2355
   00051 Fructose and mannose metabolism
    Bache_2355
Enzymes [BR:bhl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Bache_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2866815..2868131)
Genome map
AA seq 438 aa AA seqDB search
MATKEYFPGIGKIKFEGKESKNPMAFRYYDADKVIMGKKMRDWLKFAMAWWHTLCAEGGD
QFGGGTKKFPWNGDVDKIQAAKNKMDAGFEFMQKMGIGYYCFHDVDLCAEADTVEEYETN
LKTIVAYAKQKQAETGIKLLWGTANVFSHARYMNGAATNPDFDVVARAAVQIKNAIDATI
ELGGTNYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYARSKGFTGTFLIEPKPMEP
TKHQYDVDTETVIGFLKTHNLDRDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDAN
RGDYQNGWDTDQFPIDNFELVQAMMQIIRNGGLGNGGTNFDAKTRRNSTDLEDIFIAHIA
GMDAMARALENAARLLEESPYKQMLADRYASFDSGKGKEFEEGKLTLEDIVAYAKNNGEP
KQTSGKQELYEAIVNMYC
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaaagagtattttcccggaataggaaagattaaattcgaaggcaaagagagt
aagaatccgatggcgttccgctattatgatgcagataaagtaattatgggcaagaaaatg
agagactggctgaaatttgctatggcatggtggcatactctttgtgcagaaggcggagac
caatttggtggtggtacaaaaaaatttccttggaatggtgatgttgacaaaatacaagca
gccaagaataaaatggatgccggcttcgagtttatgcagaaaatgggaataggctactac
tgcttccatgatgttgatctttgtgcggaagccgatactgtggaagaatatgagactaac
ctgaaaactatcgtggcctacgctaaacaaaaacaagccgaaactggaattaaactgttg
tggggtactgccaatgtattcagtcatgcccgttatatgaatggcgcagctaccaatcct
gatttcgatgtagtggcgcgtgcagcagttcaaatcaagaatgcgattgatgcaacaata
gaattgggtggtacaaactatgtattctggggtggacgtgaaggatatatgtctttgttg
aacacagatcaaaaacgtgaaaaagagcatcttgcacaaatgctgactattgctcgtgat
tatgcacgtagtaaaggctttacaggtacgtttctgattgaaccaaaaccaatggaaccg
acaaaacatcagtacgatgtagatactgaaaccgtcatcggcttcttgaaaactcataat
ctggacagagattttaaagtaaatattgaagtaaaccatgctactttggccggccacact
tttgaacacgagttggccgttgccgttgacaatggtatgttaggatctatcgatgccaat
cgcggcgattatcagaatggttgggataccgatcagttccccatagataattttgaattg
gttcaggctatgatgcagattatccgtaatggtggcttaggtaatggcggtactaatttt
gatgctaagactcgtcgtaattccactgatttggaggatattttcattgcccacatcgca
ggtatggatgctatggctcgtgccctggagaatgcagcccgattattagaggaatctcct
tataagcagatgctggccgatcgttatgcttcttttgacagtggcaaaggcaaagaattc
gaggaaggcaaactgaccttggaggatattgtggcttatgcaaaaaacaatggcgaaccg
aaacaaaccagtggaaaacaagaactatatgaagcaatcgttaatatgtattgctga

DBGET integrated database retrieval system