KEGG   Bacteroides helcogenes: Bache_2373Help
Entry
Bache_2373        CDS       T01393                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bhl  Bacteroides helcogenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bhl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2883352..2885364
Genome map
AA seq 670 aa AA seqDB search
METLNLIKNDPWLEPYADAINGRHQHAINKEAELTNDGKQKLSDFASGYLYFGLHCTDNG
WIFREWAPNATQIFLIGTFNDWKEEKKYSLQRKANGNWEIKLPTSAMKHGDLYKLAVHWE
GGCGERIPAWATRVVQDEHTKIFSAQVWTPEQPYKMKRQTFKPSTDPLLIYECHIGMAQQ
EEKVGNYKEFQEKVLPRIAKDGYNCIQIMAIQEHPYYGSFGYHVSSFFAASSRFGTPEEL
KELIDAAHSMGIAVIMDIVHSHAVKNEVEGLGNFAGDPNQYFYSGGRREHPAWDSLCFDY
GKNEVIHFLLSNCKFWLEEYHFDGFRFDGVTSMLYYSHGLSEAFCNYGDYFNGHQDDNAI
CYLTLANRLIHEVNPKAITVAEEVSGMPGLAVKYEDGGYGFDYRMAMNIPDYWIKTIKEK
IDEDWKPSSMFWEVTNRRKDEKTISYTESHDQALVGDKTIIFRLIDADMYWHMQKGDENY
TVNRGIALHKMIRLLTATTINGGYLNFMGNEFGHPEWIDFPREGNGWSCKYARRQWDLID
NKNLSYHYMGDFDTAMLEVIKSIKKFQDTPVQEIWHNDGDQILAYMRKDLIFVYNFNPKQ
SFTDYGFLVPAGSYETILNTDNPAFGGNGLTDDAVKHFTLHDPLYEKEKKEWLKLYIPAR
TAIVLKKKNK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggaaacattgaatttgattaagaatgatccttggctggaaccttacgcagatgccatc
aacggacgccaccaacatgccataaacaaagaagctgaattaaccaacgatggaaaacag
aaactatcagactttgcatccggatatctttatttcggtttgcattgcactgacaacggt
tggatttttcgtgaatgggctcccaatgccacccaaatctttctgataggaacctttaat
gactggaaagaagaaaagaaatacagtttgcaacgtaaagcaaacggtaattgggaaatt
aaacttcctaccagcgccatgaagcacggagatctgtacaaactggcagtacattgggaa
ggtggatgcggtgaacgtatccccgcatgggctacccgagtcgttcaagacgagcatacc
aaaatattcagtgcacaggtttggacgccagagcaaccgtataaaatgaaaaggcaaaca
ttcaagccaagcactgatcctctgttgatatatgaatgccatatcggcatggcacaacag
gaagaaaaggtaggtaactacaaggaatttcaggaaaaggttcttccacgcattgctaag
gatggatataactgtatacagataatggctattcaggaacatccttattatggaagtttc
ggttatcatgtatccagtttctttgccgcttcttcccgttttggcacacccgaagaattg
aaagaactgattgacgcggctcatagcatgggaatagccgttattatggatattgtacat
tcacatgctgtaaaaaatgaagtagaaggtttaggaaattttgctggagatccgaatcaa
tatttctattctggcggacgtcgtgagcatccggcatgggattcactttgctttgattat
ggcaaaaatgaagttattcatttcttgttgtcaaattgtaaattctggttggaagaatat
cattttgatggatttcgttttgatggggtaacttccatgttatattatagccatggattg
agcgaagctttttgtaattatggagattatttcaatggacaccaagatgataatgcaatc
tgttatctgactcttgccaatcgcttaatccatgaagtgaatccgaaagctattactgtc
gctgaagaagtatctggcatgccgggattggccgtgaaatatgaggatggcggttatggc
tttgattaccgtatggctatgaatattccagattactggattaaaactatcaaagaaaaa
atagatgaggactggaaaccttccagcatgttttgggaagtcaccaaccgtcgaaaagat
gaaaaaacaatttcatatacagaaagccatgaccaagctttagttggggataaaaccatt
atttttcgcctaattgatgcagatatgtattggcatatgcaaaaaggcgatgaaaactac
actgtgaaccgaggaattgctcttcataagatgatacgcttgctgaccgcaacaaccatt
aatggtggctatctcaattttatgggtaatgagttcggccaccctgaatggatagacttt
cctcgtgagggaaatggatggtcatgtaagtatgcccgtcgtcaatgggatctgatagat
aataagaatttatcatatcattacatgggagattttgatacagctatgttagaagtaata
aaaagcataaaaaaatttcaggatacccccgtacaagagatttggcataatgatggtgat
cagatattagcatatatgcgtaaagacttgatatttgtatataatttcaatcccaaacaa
tcttttactgattatggttttttagtgcctgctggaagctatgaaacaatattgaatacg
gataatccagctttcggtggcaatggattgacagatgatgctgtaaagcatttcactctt
cacgatcctttatacgaaaaggaaaagaaagaatggttaaaactttatattcctgcacgt
actgctatagtattaaagaaaaaaaataaataa

DBGET integrated database retrieval system