KEGG   Bacteroides helcogenes: Bache_2443Help
Entry
Bache_2443        CDS       T01393                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bhl  Bacteroides helcogenes
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bhl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2953520..2953900)
Genome map
AA seq 126 aa AA seqDB search
MIYTISIGSNKHRKDNLALARRRLSELFPDICFSVEEETEPLFLHHSYLFSNQVARFVSD
CQAKEIISLLKAIEREAGRTAEEKKQEIVRLDIDLLSCDSVIYKPEDLKRDYIVRGLKQL
SPDNCG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgatttataccatcagcataggcagcaacaagcatcggaaagacaatttggctttggcg
cgcagacgattgtcggagttgtttccggatatttgtttttcggtggaagaagaaacggag
cctttgtttcttcatcattcatatctgttttccaatcaggtggcgcgttttgtttccgat
tgtcaggcaaaagagattatttctctgctgaaagctatcgaacgagaagccggaagaact
gccgaagaaaaaaaacaggaaatcgtccgcttggatattgatttactttcatgtgattct
gtaatatacaagccggaggatttgaagcgtgattatatagtacgtggtctgaagcaactc
tcgccggacaattgtggttag

DBGET integrated database retrieval system