KEGG   Bacteroides helcogenes: Bache_2542Help
Entry
Bache_2542        CDS       T01393                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bhl  Bacteroides helcogenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bache_2542
DNA repair and recombination proteins [BR:bhl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bache_2542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3063979..3064596)
Genome map
AA seq 205 aa AA seqDB search
MNGQYPSTLLEKAVSEFAKLPGVGRKTAMRLVLHLLRQDTMAVEAFGNAIITLKHEVKYC
KVCHNISDTEICRICSNPQRDSSVVCVVENIRDVMAVEATQQFRGLYHVLGGVISPMDGI
GPGDLQIESLVQRVSSGDIKEVILALSTTMEGDTTNFYIYRKLEKMGVKLSVIARGISVG
DELEYADEVTLGRSIVNRTPFTGTV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacagtatccctcgacattattggaaaaggcagtcagtgagtttgccaaactg
ccgggtgtgggacgtaaaacagcaatgagactggtgcttcatcttctgcgtcaggatacg
atggcagtggaggctttcggtaatgccatcattacgttgaagcatgaagtgaagtattgc
aaagtatgccataatatttcagatacggaaatatgccgtatctgttccaacccgcagcgt
gattcttctgtcgtctgtgtggtggaaaacatccgtgacgtcatggcagtagaggctaca
cagcagtttcgcgggctgtaccatgtattgggaggcgttatctctccaatggatgggatt
ggtcccggtgatttgcagatcgaaagccttgtgcaacgtgtttcttcgggggatataaaa
gaagtgatacttgccctgagcaccacgatggaaggagacactacgaatttctatatatat
cgcaaattggaaaaaatgggcgtgaagctttcagtaatagcccgtggtatttctgtcggc
gatgaattggagtatgccgatgaggtaacactcggacggagtatagtcaaccgtactccg
tttacgggaacggtataa

DBGET integrated database retrieval system