KEGG   Bacteroides helcogenes: Bache_2542Help
Entry
Bache_2542        CDS       T01393                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bhl  Bacteroides helcogenes
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bhl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3063979..3064596)
Genome map
AA seq 205 aa AA seqDB search
MNGQYPSTLLEKAVSEFAKLPGVGRKTAMRLVLHLLRQDTMAVEAFGNAIITLKHEVKYC
KVCHNISDTEICRICSNPQRDSSVVCVVENIRDVMAVEATQQFRGLYHVLGGVISPMDGI
GPGDLQIESLVQRVSSGDIKEVILALSTTMEGDTTNFYIYRKLEKMGVKLSVIARGISVG
DELEYADEVTLGRSIVNRTPFTGTV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacagtatccctcgacattattggaaaaggcagtcagtgagtttgccaaactg
ccgggtgtgggacgtaaaacagcaatgagactggtgcttcatcttctgcgtcaggatacg
atggcagtggaggctttcggtaatgccatcattacgttgaagcatgaagtgaagtattgc
aaagtatgccataatatttcagatacggaaatatgccgtatctgttccaacccgcagcgt
gattcttctgtcgtctgtgtggtggaaaacatccgtgacgtcatggcagtagaggctaca
cagcagtttcgcgggctgtaccatgtattgggaggcgttatctctccaatggatgggatt
ggtcccggtgatttgcagatcgaaagccttgtgcaacgtgtttcttcgggggatataaaa
gaagtgatacttgccctgagcaccacgatggaaggagacactacgaatttctatatatat
cgcaaattggaaaaaatgggcgtgaagctttcagtaatagcccgtggtatttctgtcggc
gatgaattggagtatgccgatgaggtaacactcggacggagtatagtcaaccgtactccg
tttacgggaacggtataa

DBGET integrated database retrieval system