KEGG   Bacteroides helcogenes: Bache_2731Help
Entry
Bache_2731        CDS       T01393                                 

Definition
(GenBank) Fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00010  Glycolysis / Gluconeogenesis
bhl00030  Pentose phosphate pathway
bhl00051  Fructose and mannose metabolism
bhl00680  Methane metabolism
bhl01100  Metabolic pathways
bhl01110  Biosynthesis of secondary metabolites
bhl01120  Microbial metabolism in diverse environments
bhl01130  Biosynthesis of antibiotics
bhl01200  Carbon metabolism
Module
bhl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_2731
   00030 Pentose phosphate pathway
    Bache_2731
   00051 Fructose and mannose metabolism
    Bache_2731
  Energy metabolism
   00680 Methane metabolism
    Bache_2731
Enzymes [BR:bhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Bache_2731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ADV44676
UniProt: E6SWY8
Position
complement(3267277..3269265)
Genome map
AA seq 662 aa AA seqDB search
MGNTTPETIANDLRYLQLLSRSFPTIADASTEIINLEAILNLPKGTEHFLTDIHGEYEAF
QHVLKNASGAVKRKVNEIFGHTLRESEKKELCTLIYYPEEKLQLIKEQETDLDDWYLITL
NQLVKVCQNVSSKYTRSKVRKALPAEFSYIIQELLHESTIEPNKHAYINVIISTIITTKR
ADDFIVAMCNLIQRLTIDSLHIVGDIYDRGPGAHIIMDTLCDYHNFDIQWGNHDILWMGA
ASGNDACIANVIRMSLRYANLATLEDGYGINLLPLATFAMDTYADDPCTIFAPKMNFADA
EYNDKTLRLITQMHKAITVIQLKLEAEIISRRPDFNMEDRKLLHNINFERGVYVCDGKEY
ALLDTNFPTVDPADPYRLTDEERELVNRIHTSFMNSEKLKKHMRCLFTYGGMYLVCNSNL
LYHASVPLNVDGSFKHVRIGKKDYWGHKLLQKTDQLIRTAYFEEDGSAEKLFALDYVWYM
WCGSDAPSFDKDKMATFERYFVADKSLHKETKGCYYSLRNEAEVCDRILSEFGVEPGSHS
HIINGHVPVKTIKGEKPIKANGKLLVIDGGFSKAYQPETGIAGYTLVYHSHGLQLVQHEP
FQSRQKAIEEGQDIKSTTFVVEFNSQRMMVKDTDKGAELITQIEDLKKLLVAYRTGFIKE
KQ
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatacaactccggaaactattgcaaatgacctacgttatttacaattattgtca
cgcagctttcctactatagcagatgccagtacggaaattatcaatctggaagcgatcttg
aacctgccgaaaggtacggagcattttttgaccgatattcatggtgaatacgaagctttt
cagcatgtcctgaaaaacgcgtcaggtgcggtgaagcgtaaagtgaatgaaattttcggc
catacgctgcgtgaaagcgaaaagaaggaactctgtacgttgatttactatccggaagaa
aagttgcaactgataaaggaacaggaaacagatttggatgattggtatctgataactttg
aaccagttggtaaaagtctgccagaatgtttcttccaaatatacccgttccaaagtgcgc
aaggcacttccggcggaattctcgtatatcatccaggaattgttgcacgaatcgaccatc
gaaccaaataagcatgcatatattaatgtcattatcagcactatcataacaacgaaacgt
gcggatgatttcattgtggcgatgtgcaaccttatccaacgcctgacaattgattctttg
catatcgtgggtgatatttacgaccgtggaccgggagcacatattattatggatacgctt
tgtgattatcataatttcgatatccagtggggcaaccatgatatcctgtggatgggcgcg
gcttcgggcaatgacgcttgcattgccaatgtaatccgtatgtctctgcgctatgccaat
ctggccactctggaagatggatacggcattaatctgctgccactcgctacatttgcgatg
gatacttatgccgatgatccctgtaccatttttgcaccgaaaatgaattttgccgatgca
gaatataatgacaagaccctgcgcctgattacacagatgcacaaggccattacggtcatt
caacttaaattagaagcggaaatcatcagccgacgtccggatttcaacatggaggatcgt
aaactgctgcataatatcaattttgagcgtggtgtgtatgtatgtgatgggaaggaatac
gcactgctcgacaccaatttcccgaccgttgatcctgccgatccatatcgcttgacagat
gaggagcgtgaattggtgaacagaatccacacctcattcatgaacagtgagaaactgaag
aaacacatgcgttgcctgttcacgtatgggggcatgtatctggtttgcaacagtaacctg
ctatatcatgcatccgttcctctgaatgtggatggcagtttcaagcatgttcgtattggg
aagaaggactattggggacataagttgctgcagaagacggatcagttgatacgtaccgct
tattttgaagaggacggttctgccgagaagttgtttgcgctggattatgtatggtatatg
tggtgcggatctgatgctccttcctttgataaggataagatggcgacattcgaacgttat
tttgtggcggacaaaagcctgcataaagagacaaagggctgttattactctttgcgcaat
gaggcggaagtctgcgaccgtattcttagcgagttcggtgtggagccagggtctcattca
cacatcatcaacggtcatgtacctgtaaagaccatcaagggggagaagcccatcaaggcc
aatggcaaattgcttgtgattgacggcggcttttcaaaagcctatcagcctgaaacgggg
attgccggctatactttggtatatcattcacacggtctgcaattagtgcagcatgagccg
tttcaaagccgtcagaaagccattgaggagggacaggatatcaaatccactacttttgtt
gtagaattcaactcccagcgtatgatggtgaaagatactgataaaggtgctgaactcatc
acccagatagaagacttgaagaagttgcttgtggcttatagaaccgggtttattaaagag
aaacaataa

DBGET integrated database retrieval system