KEGG   Bacteroides helcogenes: Bache_2771Help
Entry
Bache_2771        CDS       T01393                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bhl  Bacteroides helcogenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bhl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3313458..3314855
Genome map
AA seq 465 aa AA seqDB search
MAKATTIETRQCDVIVIGAGITGLTTAFYLTRRQKNVEVLERQNRIGGQIQTFHEDGFVF
ESGPNTGVISCPEVAELFSDLSGDCEPETAFEASKRRLIWKGECFHPLPSGITSAIFTPL
FSLKDKLRILGEPFRPKGDDPDETIGMLAKRRLGKSFLDYAVDPFLSGVYAGDPMRLVTR
FALPKLYHLEQRYGSFVKGAIAKIREHKNNRDKLATKQVFSPRNGFSRLIEALERQIGSR
RITLGVEDITILPHHNHWKVRFTNSTGRMQEIHCTQVITTVGAYALPDLLPFIAQEQMHK
ICNLHYAPVIQVSVGLHHTGGIHHAAFGGLIPSCENKPLLGILFPSACFKNRAPEEGALF
SCFIGGVRHPEYLMKSDDEIIALVTDALHSMLHYPLKSNPDMIRIFRHKKAIPQYDAGCG
ERLATIEYLQKQYPGLVLGGNIRDGIGIADRIRQAVALASDLQLV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcaacgactatcgaaacacgccaatgtgatgttatcgttatcggagccgga
atcaccggactgacaacagcattttatcttacccgcaggcaaaaaaatgtagaagtgctt
gaacggcagaaccgaatcggcggacaaattcaaacttttcacgaagatggatttgtcttt
gaaagcggtccgaacacaggagtgatatcttgtccggaagtagctgaacttttttcggat
ctttctggtgactgtgagcctgaaacagcttttgaagcatccaaacggaggcttatttgg
aaaggagaatgctttcatccacttccttcaggaattacaagtgcaattttcactcctcta
tttagcctgaaagacaaattgcgtatattgggagaacctttccgccccaaaggagatgat
cccgatgaaacgataggtatgttggcaaaacgtcgtttaggaaaatcatttcttgattat
gctgttgaccctttcctatctggagtctatgctggtgacccgatgaggctggtcactcgc
ttcgcattacccaagctctaccatttggagcaacgttacgggagttttgtcaaaggagca
attgcaaagataagagaacataaaaacaaccgcgacaaactggctaccaaacaagtgttt
tcacctcgaaacggattcagccggctgatcgaggcattagaacggcaaataggttcaaga
cggatcacacttggagttgaagacatcactatcctgccacatcacaatcattggaaagtc
cgttttacaaacagtacgggcaggatgcaagaaatacattgtacccaagtgatcactacg
gtaggagcatacgcgttgcccgatcttctacccttcattgcccaagaacaaatgcataag
atttgtaatctgcattatgctccagtaatacaagtcagtgttggattacatcatacagga
ggaatacaccatgcagctttcggtggtctgataccctcatgcgaaaacaaacctttgctg
ggaatcctctttccttctgcatgtttcaaaaaccgagctccggaagaaggagctttgttc
tcctgctttatcggaggagtgcgccaccctgaatacctgatgaaaagtgatgatgaaatc
atagcattagtcacagatgcattacattccatgcttcattaccccttgaaaagcaatccc
gatatgatccgcattttcaggcacaaaaaagcaattccacaatatgatgccggctgtggc
gaacgcctggccacaatcgaatatttgcaaaagcaatatcccgggctggttctgggaggt
aatataagagacggaatcggaatagctgaccgcattcgccaagcagtagccctggcatcc
gatttacaacttgtttaa

DBGET integrated database retrieval system