KEGG   Bacteroides helcogenes: Bache_2794Help
Entry
Bache_2794        CDS       T01393                                 

Definition
Beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bhl  Bacteroides helcogenes
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bache_2794
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bache_2794
Enzymes [BR:bhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bache_2794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3346671..3348761
Genome map
AA seq 696 aa AA seqDB search
MPKHHFIIHVLLITAFFGMSRNEVNAQSVIPVPLKMEQGNGIFRISKETKIYANLKGKEK
KNFNDYLTTLPAPFNVGISTKNGKNENTIILHKAKQGTERAISGPEDYVLEITDRKATIC
AYSDAGLFYGLQTLLQLAEEDGNGTWAVKNIRVEDSPRFSYRGFMLDVSRHFRSKEFVKK
QIDALAYFKLNRLHLHLTDGAGWRIEIKKYPRLTEFAAWRPEANWKKWWFGENARKYCEQ
SDPRAQGGFYTQDDIRELVNYAAERHITIIPEIEMPAHSEEVLAAYPELSCPEEPYKSAD
FCVGNEKTFTFLENVLTEVMKLFPSEYIHIGGDEAGKAAWKTCPKCKQRMQNEDLKDVNE
LQSYLIHRIETFLNAHGRKLLGWDEIMEGGLAPNATVMSWRGEEGGINAVKAGHRAIMSP
GSHCYIDGYQDAPYSQPEAIGGYLPLSKVYDYNPIPAALTTEESKLIYGVQANLWCEYIP
TAEHCEYMIYPRILALAEVAWSAPARKSYTDFHPRALKAVEWLKAQGYHPFDLKNEIGNR
PEASQPVKHLALGKSVKYNAPYNASYAAHGDKSLTDGVCGGWTYSDGIWQGFISSNRLDV
VIDMETETELHSISADFLQVVGPEVFLPGQIIISVSSNGTEFTELSRTTYPVVKSDIVAI
KRYGWQGEARARYIRYQALAGQEFGGWIFTDEIVVK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaacaccactttatcatccatgtcctactcataactgccttctttgggatgagc
agaaatgaagtaaacgcacaatccgtcattccggttccattaaagatggaacaaggaaac
ggtatattccgaatatcaaaagaaacaaaaatatacgctaacctcaaagggaaagaaaag
aaaaacttcaatgactatctcaccaccttgcctgcacctttcaacgtcggcatcagcacc
aagaatggcaagaacgagaataccatcatcttgcacaaagctaaacaaggaacagaacgg
gctatcagcggccccgaagactatgtgctggaaataaccgaccgaaaggctactatctgt
gcctattcggatgccggtcttttttatggcttgcaaacactgctacaattggccgaagaa
gacggaaacggcacgtgggcggtgaaaaacatacgagtggaagacagtcctcgtttctcc
taccggggctttatgttagatgtttcccgccacttccgttccaaagagtttgtaaagaag
cagattgacgcattggcatatttcaagttaaatcgcctgcatctgcatctcacagatgga
gccggctggcgaatagaaatcaaaaaatatccccgcctcacagaatttgccgcttggaga
cctgaagcgaattggaagaaatggtggttcggtgaaaatgcccgcaaatattgcgaacaa
agtgaccctcgtgcacagggaggattctatacacaagatgatatccgggaattagtgaac
tacgctgctgaacgtcacatcacaattatcccggaaatagaaatgccagcacactctgaa
gaagtattggcagcctatcctgaactttcgtgtccggaagaaccttacaaaagtgccgac
ttctgtgtgggcaacgaaaaaacattcacttttctcgaaaatgtattgaccgaagtcatg
aagcttttcccatccgaatatatacatatcggtggtgacgaagccggcaaagctgcatgg
aaaacttgtccgaaatgtaagcaacgcatgcaaaacgaagatcttaaagatgtgaatgaa
ttgcaaagttacttgattcatcgcatagagacatttctgaatgctcatggccgcaaactt
ctgggctgggatgagatcatggaaggcggactggcgccaaatgccacagtaatgtcatgg
cgtggtgaagaaggtggaatcaatgcggtcaaggcaggacatcgggccattatgtccccc
ggatcgcactgttatatagatggctatcaggatgctccttattcacaacccgaagccatc
ggaggatatctgcccttatccaaagtttacgattataatcccatcccggcagcactgact
acagaagagagcaaactcatttatggcgtgcaagctaacctatggtgtgaatacataccc
accgccgagcattgtgaatacatgatctatccccgaattcttgcattagccgaagtagcc
tggagtgctcctgcacgtaaatcatatacagattttcacccccgggccttaaaagccgtg
gaatggctgaaagcacaaggataccacccgttcgacttaaagaacgagataggtaaccgc
cctgaagcgtcacagcccgtcaagcacttggcattaggaaaatcagtaaaatacaacgct
ccttacaatgcttcgtatgcagcccatggagacaagagcctcacagatggtgtatgtggc
ggttggacttattccgatggcatatggcaaggatttatctcaagcaaccggttggatgta
gtcattgacatggaaacagagacagagcttcactccatcagtgccgactttctgcaagta
gtgggtcccgaagtgttccttcccggtcagataatcatatctgtatcttcgaacggaacc
gagttcacagaactatcacgaaccacatatccggttgtaaaatcagatattgtggccatt
aaaagatacggatggcaaggagaagcccgcgcccgatacatacgctatcaagcattggca
ggccaagaattcggcggttggattttcacagacgagattgtggtaaaataa

DBGET integrated database retrieval system