KEGG   Bacteroides helcogenes: Bache_3212Help
Entry
Bache_3212        CDS       T01393                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00230  Purine metabolism
bhl01100  Metabolic pathways
Module
bhl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bache_3212
Enzymes [BR:bhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Bache_3212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 RsgA_GTPase AAA_22 AAA_16 ABC_tran AAA_29 CPT RNA_helicase cobW AAA_23
Motif
Other DBs
NCBI-ProteinID: ADV45136
UniProt: E6SRP6
Position
complement(3814776..3815339)
Genome map
AA seq 187 aa AA seqDB search
MGKLIIFSAPSGAGKSTIINYLLAQNLNLSFSISATSRPPRGTEKDGVEYFFLTPDEFRR
RIANNEFLEYEEVYQDRFYGTLKAEVEKQLAAGQNVVFDVDVVGGCNIKKYYGERALSVF
IQPPSVEELRKRLVGRGTDAPEVIENRVAKAEYELGFVSKFDTVIVNDDLEAAKSEALGV
ITRFLNS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaactgattatattctctgccccctccggggcgggtaagtcaacgattatcaac
tatctgttggcgcagaatctgaacctttccttttctatttcggcaaccagccgtccgcct
cgaggaactgaaaaggatggggtggaatatttctttctgactcccgatgagtttcgccgc
cgcattgccaataatgagtttctggagtatgaagaagtgtatcaggatcgtttttacggt
acactgaaggcagaggtggagaagcaattggctgccggacagaatgtagtgtttgatgtt
gatgtagtgggtggctgcaatatcaagaaatactatggtgaacgtgccttgtctgttttc
attcagcctccctcggtggaagaattgcgcaagcgtctggtagggcgtggaacggatgct
cctgaagtgatagagaaccgtgtggcaaaggctgaatatgaacttggttttgtctcgaag
ttcgacacggtgattgtgaatgacgatttggaggcggcaaaaagcgaggctttaggagta
atcactcgttttctcaattcataa

DBGET integrated database retrieval system