KEGG   Bacteroides helcogenes: Bache_3312Help
Entry
Bache_3312        CDS       T01393                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00010  Glycolysis / Gluconeogenesis
bhl00030  Pentose phosphate pathway
bhl00051  Fructose and mannose metabolism
bhl00052  Galactose metabolism
bhl00680  Methane metabolism
bhl01100  Metabolic pathways
bhl01110  Biosynthesis of secondary metabolites
bhl01120  Microbial metabolism in diverse environments
bhl01130  Biosynthesis of antibiotics
bhl01200  Carbon metabolism
bhl01230  Biosynthesis of amino acids
bhl03018  RNA degradation
Module
bhl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_3312
   00030 Pentose phosphate pathway
    Bache_3312
   00051 Fructose and mannose metabolism
    Bache_3312
   00052 Galactose metabolism
    Bache_3312
  Energy metabolism
   00680 Methane metabolism
    Bache_3312
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Bache_3312
Enzymes [BR:bhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bache_3312
Protein phosphatases and associated proteins [BR:bhl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bache_3312
Messenger RNA biogenesis [BR:bhl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Bache_3312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADV45235
UniProt: E6ST31
Position
3943915..3944895
Genome map
AA seq 326 aa AA seqDB search
MGMVKCIGILTSGGDAPGMNAAIRAVTRAAIYNGLSVKGIYRGYKGLVTGEIKEFKSQNV
SNIIQLGGTILKTARCKEFTTPEGRQTAYDNMKREGIDALVIIGGDGSLTGARIFAQEFD
VPCIGLPGTIDNDLYGTDTTIGYDTALNTILDAVDKIRDTATSHERLFFVEVMGRDAGFL
ALNGAIASGAEAAIIPEFSTEVDQLEEFIKNGFRKSKNSSIVLVAESELTGGAMHYAERV
KNEYPGYDVRVTILGHLQRGGSPTAHDRILASRLGAAAIDAIMEGQRNVMIGIEHDEVVY
VPFTKAIKNDKPIKKDLVNVLRELSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggttaagtgtatcggtatcctgacctccggaggcgatgctccgggaatgaat
gctgccatacgtgcagtgacacgcgcagctatctacaacggactctcagtaaaaggcata
tacagaggttacaaaggtttagtgaccggcgaaatcaaagaattcaaaagccagaatgta
agtaatatcatacagttggggggcacaattctcaagaccgcacgctgcaaggaatttacc
actcccgaaggacgccagactgcctatgataacatgaaaagggaaggcattgacgctctg
gtcataataggcggcgacggctctctcacgggcgcacgcatctttgcgcaggaatttgac
gttccctgtatcggattgcccggaactatcgacaatgacctttacggaacagacaccacc
atcggatatgacactgctttgaatacgattctggatgcagtcgataagatccgtgatacc
gcaacttcgcacgaacggttgttcttcgttgaagtaatggggcgtgacgccggcttcctt
gccctgaacggtgcaatcgcatccggtgctgaggcagccatcataccggaattcagtacc
gaagtggaccaactggaagagttcatcaagaatggtttccgaaaatcaaaaaacagcagt
atcgtgttagtggccgaaagtgaactgaccggcggagccatgcactatgcagaacgcgtg
aagaatgagtatccgggatacgacgtgcgcgtaaccatcctcggacacctgcagcgcggc
ggaagccccacggcacacgaccgcatccttgccagtcgcctgggtgcagcggcaatcgat
gctatcatggaaggacagcgcaatgtcatgatcggcattgagcacgatgaagtggtttat
gttcctttcaccaaagctatcaagaatgacaagcccatcaagaaagatttggtaaatgta
ttgagagaattgtctatctga

DBGET integrated database retrieval system