KEGG   Bacteroides helcogenes: Bache_3312Help
Entry
Bache_3312        CDS       T01393                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bhl  Bacteroides helcogenes
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bache_3312
   01230 Biosynthesis of amino acids
    Bache_3312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_3312
   00030 Pentose phosphate pathway
    Bache_3312
   00051 Fructose and mannose metabolism
    Bache_3312
   00052 Galactose metabolism
    Bache_3312
  Energy metabolism
   00680 Methane metabolism
    Bache_3312
Enzymes [BR:bhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bache_3312
Protein phosphatases and associated proteins [BR:bhl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bache_3312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3943915..3944895
Genome map
AA seq 326 aa AA seqDB search
MGMVKCIGILTSGGDAPGMNAAIRAVTRAAIYNGLSVKGIYRGYKGLVTGEIKEFKSQNV
SNIIQLGGTILKTARCKEFTTPEGRQTAYDNMKREGIDALVIIGGDGSLTGARIFAQEFD
VPCIGLPGTIDNDLYGTDTTIGYDTALNTILDAVDKIRDTATSHERLFFVEVMGRDAGFL
ALNGAIASGAEAAIIPEFSTEVDQLEEFIKNGFRKSKNSSIVLVAESELTGGAMHYAERV
KNEYPGYDVRVTILGHLQRGGSPTAHDRILASRLGAAAIDAIMEGQRNVMIGIEHDEVVY
VPFTKAIKNDKPIKKDLVNVLRELSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggttaagtgtatcggtatcctgacctccggaggcgatgctccgggaatgaat
gctgccatacgtgcagtgacacgcgcagctatctacaacggactctcagtaaaaggcata
tacagaggttacaaaggtttagtgaccggcgaaatcaaagaattcaaaagccagaatgta
agtaatatcatacagttggggggcacaattctcaagaccgcacgctgcaaggaatttacc
actcccgaaggacgccagactgcctatgataacatgaaaagggaaggcattgacgctctg
gtcataataggcggcgacggctctctcacgggcgcacgcatctttgcgcaggaatttgac
gttccctgtatcggattgcccggaactatcgacaatgacctttacggaacagacaccacc
atcggatatgacactgctttgaatacgattctggatgcagtcgataagatccgtgatacc
gcaacttcgcacgaacggttgttcttcgttgaagtaatggggcgtgacgccggcttcctt
gccctgaacggtgcaatcgcatccggtgctgaggcagccatcataccggaattcagtacc
gaagtggaccaactggaagagttcatcaagaatggtttccgaaaatcaaaaaacagcagt
atcgtgttagtggccgaaagtgaactgaccggcggagccatgcactatgcagaacgcgtg
aagaatgagtatccgggatacgacgtgcgcgtaaccatcctcggacacctgcagcgcggc
ggaagccccacggcacacgaccgcatccttgccagtcgcctgggtgcagcggcaatcgat
gctatcatggaaggacagcgcaatgtcatgatcggcattgagcacgatgaagtggtttat
gttcctttcaccaaagctatcaagaatgacaagcccatcaagaaagatttggtaaatgta
ttgagagaattgtctatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system