KEGG   Bordetella holmesii ATCC 51541: D560_1082Help
Entry
D560_1082         CDS       T03052                                 

Definition
phosphoenolpyruvate carboxylase family protein
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D560_1082
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    D560_1082
  Energy metabolism
   00680 Methane metabolism
    D560_1082
Enzymes [BR:bho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     D560_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
complement(1019220..1021985)
Genome map
AA seq 921 aa AA seqDB search
MIQACEGKRVFDTIETLRRSAVRFRRQGREEDGQLMQQLVKQLRSDDPNLVARAFSYFLH
LFNIAEDRDQNRRKRARALTDPAAAAGSLRQTVQLLHAQGVTAARIRRLIGEACVMPVLT
AHPTEVQRKSTLDAHREIAALITQRDQPLTHDEIAEIDSALLGRVDTLWQTRMLRNTRLT
VADEIENALSYYRSTFLAAIPRLYADLSRLLGQEAANPFAAPPAPLEPFLRMGSWIGGDR
DGNPNVDAATLDLALLRQATVVFEHYLNEIHALGAEVSVSTLLIDAGDALQELADAGGDT
SPHRRDEPYRRALIGIYARLAATARTLTGRELALRAALPAQPYPHPQAFAQDLAVIAESL
ASHHGTPIAKLRLSGLQQAVEVFGFHLATVDLRQSSDVHERVLTELLARAAQDDPGPSYD
QLDEEARVQLLRRELATARPLASPWITYSEDTTRELAVLRAAAAARARYGRAAVRQAIVS
HTETLSDLLEVLVLQKETGLISPAGTQPQPEDGLMVVPLFETIPDLERGPAIMAAWLDLP
EVRQRVRLAQNESQEVMLGYSDSNKDGGYLTSNWSLYRAERELVDVFRARQVKLRLFHGR
GGSVGRGGGSSFDAIVAQPPGTVAGQLRLTEQGEVIQTKYKNADIGRWHLELLVSAVLQA
SLAQQPAAARQAEDAHMAHHGQTMDFLSASAQTGYRKLVYDTPGFDDYFFAATPINEIAG
LNIGSRPASRKQGQKIEDLRAIPWGFSWAQCRLMLTGWYGMGSALQAYLEEGATGAPRSK
RARLAQLREMARDWPAFRTLLSNMEMVLAKSDLAIASRYAMLVPQRGLRERIFGAISDEH
GRTLAMLKLINQRDLLADNPALAASLRERFAYIDPLNYLQIDLLRRQRASQRRPDAKADP
RITPAIHLTINGIAAGLRNSG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
gtgattcaggcctgcgaaggcaaacgggttttcgacaccatagagacgctgcgccgcagc
gccgtgcgtttccgccgccaaggacgggaagaggatggccaactcatgcagcaactggtc
aaacagttgcgctcggacgaccccaacctcgtggcgcgggccttcagttattttctgcac
ctgttcaacatcgccgaggatcgcgaccagaatcgccgcaagcgcgcccgggcgctgacc
gatcccgctgcggcggccggcagcctgcgccagaccgtgcaactgttgcatgcgcagggt
gtgacggcggcgcgcatacgccgcctcatcggcgaggcctgcgtcatgccggtactgacc
gctcaccccaccgaagtccagcgcaaaagcacgctggatgcccaccgcgagatcgccgca
ctcatcacccaacgtgatcagccgttgacccacgacgaaatcgccgagatcgacagtgcc
ctgctcggccgcgtggacacgctctggcagacgcgcatgctgcgcaacacgcgcctgacc
gtcgccgacgaaatcgaaaacgcgctgagctactaccgcagcaccttcctggcggccatc
ccccgcctgtacgccgatctgtcccgcttgctgggccaggaagccgccaatcccttcgct
gccccgcctgcgccgctcgagccgttcttgcgcatgggcagttggataggcggtgaccgc
gacggcaatcccaatgtagacgccgccaccctcgacctggcattgctgcgccaggccacg
gtggtgttcgagcactatctgaacgagatccatgctctgggcgcggaagtctcggtcagc
accttgctgatcgacgccggcgatgcgttgcaggaactggccgatgccggcggcgacacc
tcaccccatcgccgggacgaaccctaccggcgcgcgctgatcggcatttatgcccgtctg
gcggccaccgcccgcacgctaaccggccgcgaactggcgctcagggcggccctgcccgcg
caaccctatccccatccgcaggcgttcgcgcaggacctggccgtcattgccgaatcgctg
gccagccatcacggcacaccgatcgcaaagctccgtctgtcaggcctgcaacaggccgtc
gaagtgttcggctttcacctggccacggtggacctgcgccaaagctctgacgtgcacgag
cgtgtcctgaccgagctcctggcacgcgcggcgcaggatgacccgggtcccagctacgac
cagttggatgaagaggcccgcgtgcaactgctgcgccgcgagctggccaccgcgcgtccg
ctggcttcgccctggattacgtacagcgaagacaccacacgcgaactcgccgtgctgcgc
gcggccgcggccgcgcgtgcacgctatggccgcgccgccgtacggcaggccatcgtgtcg
cacaccgaaaccctgagtgatctgctcgaagtcctcgtgctgcagaaagaaaccgggctt
atttccccggcgggcacgcagccccaacccgaagacggcctgatggtcgtgccgttgttc
gaaaccatccctgacctcgaacgcggcccggccatcatggccgcctggctggatctgccc
gaagtccggcagcgcgtgcgtctggctcagaacgagagccaggaagtcatgctgggatac
tccgacagcaacaaagacggcggatacctgacgtccaactggtcgctctatcgcgccgag
cgcgaactggtcgatgtctttcgcgcccgccaggtcaaactgcgcctgttccatggccgc
ggcggctccgtgggccgcggcggcggctccagtttcgacgccatcgtcgcgcagcctccg
ggcaccgtggccggccagcttcgcctgaccgagcaaggcgaagtcatccagaccaagtac
aaaaatgccgatatcggacgctggcatctggaactgctggtatctgccgtgctgcaggcc
tcgctggctcagcaacccgccgccgcacgccaggccgaagacgcccacatggcgcaccac
ggccagaccatggacttcctgtcggccagcgcgcagaccggctatcgcaaactggtctac
gacaccccgggctttgacgactacttcttcgcggccacgcccatcaacgaaatcgccggc
ctgaacatcggttcgcgcccggcctcacgcaagcaaggccaaaagatcgaagacctgcgc
gccatcccctggggattctcgtgggcgcaatgccgcctcatgctcaccggctggtacggc
atgggctcggcccttcaggcctatctcgaagagggcgcgactggcgcgccgcgcagcaaa
cgtgcccgcctggcgcaattgcgcgaaatggcccgggactggccggccttccgcaccttg
ctgtccaacatggagatggtgctggccaaatccgatctggccatcgcctcgcgctacgcc
atgctggtgccgcagcgcggcctgcgcgaacgcatcttcggcgccatctcggatgagcat
gggcgcacgcttgccatgctcaagctcatcaaccagcgcgacctgctggccgacaacccc
gcactggctgcctcgctgcgcgagcgctttgcctacatcgatccgctgaactatctgcag
atcgatctgctgcgccgccagcgcgccagccagcgccggccagacgccaaggcggaccca
cgcatcacgcccgccattcacctgaccatcaacggcatcgccgcaggcctgcgcaactca
ggttga

DBGET integrated database retrieval system