KEGG   Borrelia hermsii HS1: BH0023Help
Entry
BH0023            CDS       T00764                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bhr  Borrelia hermsii HS1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bhr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BH0023
Enzymes [BR:bhr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BH0023
DNA repair and recombination proteins [BR:bhr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BH0023
    RecFOR pathway proteins
     BH0023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(22473..23063)
Genome map
AA seq 196 aa AA seqDB search
MINKIYGKIIEKRESSIVIVALPFEFEVLVSSFCNAELRLLEDVEILTYLHLREDEIKLF
GFLNVSEREVFEELISVDGIGPRAALRMLSGMKYDEFRDAIEREDVKRISTVKGIGNKVA
GKIFLKLRGKLVKADELTSSVFKFKDLEQSIVNMGFDRKLVVAAIKEIMLIDEFLMLREV
EQEQFLFRETLKRLSG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcaataaaatttatggtaaaattatagagaaaagagaatctagtattgtaattgta
gcacttccctttgaatttgaggttttggttagttctttttgtaatgcagaattgaggttg
ctggaagatgttgaaatattaacttatcttcatcttcgagaagatgaaattaaacttttt
gggtttttaaatgtatcagagagagaagtttttgaagaacttattagtgttgatggaata
ggaccaagagcggctctaaggatgctatctggaatgaaatatgatgaatttagagatgca
attgaaagggaagacgttaagcgtatttctacggtcaaaggcattggaaataaagtagca
ggcaaaatatttttaaaacttagaggaaaacttgttaaagctgatgagttgacctcaagt
gtatttaaatttaaagatcttgaacagtcaattgttaatatgggttttgatagaaaattg
gttgtagctgctattaaggaaattatgcttattgatgaatttttaatgttaagagaagtt
gaacaagaacagtttttatttagagaaactttaaaaaggctttcaggttag

DBGET integrated database retrieval system