KEGG   Borrelia hermsii: BH0055Help
Entry
BH0055            CDS       T00764                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bhr  Borrelia hermsii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bhr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BH0055 (tpiA)
   01230 Biosynthesis of amino acids
    BH0055 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH0055 (tpiA)
   00051 Fructose and mannose metabolism
    BH0055 (tpiA)
   00562 Inositol phosphate metabolism
    BH0055 (tpiA)
Enzymes [BR:bhr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BH0055 (tpiA)
Exosome [BR:bhr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BH0055 (tpiA)
  Exosomal proteins of bladder cancer cells
   BH0055 (tpiA)
  Exosomal proteins of melanoma cells
   BH0055 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(50109..50873)
Genome map
AA seq 254 aa AA seqDB search
MRKMFLAGNWKMHYTSVEAAGVAKQIVDGVQNINDDVVIMITPAFTSLCKVCEVTKGSNV
LLGAQNMSYENSGARTSEISPSMLLEFGVDYVILGHSECRTYLGDTDEVINKKILAGLKH
PFKYLILCIGETLSERENNKTLDVVLNQIRRGLMSVSESDLKRIILAYEPVWAIGTGKTA
TKEEAQEVHRAIRLEIESLYSTSAADDIIIQYGGSVNVDNVGGLMGENDIDGALIGGASL
KADSFLNIVNKVAK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatgtttttagctggaaactggaaaatgcactatacaagtgtagaggctgca
ggtgttgcaaaacaaattgtagacggagtacaaaatattaatgatgatgttgtgattatg
ataacacccgcatttacgtctctttgtaaagtttgcgaagttactaagggaagtaatgtt
cttcttggtgctcaaaatatgtcttatgagaatagtggagcaagaacaagtgaaatttca
ccttctatgcttttagaatttggagttgattacgtaatacttggtcattctgaatgtagg
acttatcttggagatactgatgaagtaataaataagaaaattcttgcaggacttaaacat
ccatttaaatatttaattctttgtattggggaaactctttcggagagagaaaataataaa
accttagatgttgttttaaatcaaattagaagaggcttaatgtctgtttctgaatctgat
cttaagcgaataattttagcttatgagcctgtgtgggcaattggaactggaaaaaccgca
acaaaagaagaggcacaagaggttcacagggcaattagacttgagattgaatcattgtat
tcaacctcagcagcagatgacattattattcagtatggtggttctgttaatgttgataat
gtgggaggccttatgggggaaaatgacattgatggagcgttgattggtggtgcatcttta
aaggccgattcatttttgaatatagttaataaggtggccaaatag

DBGET integrated database retrieval system