KEGG   Borrelia hermsii: BH0166Help
Entry
BH0166            CDS       T00764                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bhr  Borrelia hermsii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bhr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(166640..168121)
Genome map
AA seq 493 aa AA seqDB search
MKRKSGILLNISSLPSKYGIGDLGKGAYKFIDFLVASSQSYWQILPYSPSNFIEFPYSSY
SAFAGNINYIDLSAIDRFIDVSLSTLECLEDRSIDYDKLKAKEVVLRNAALNFLHRATVD
EMHAFEKFKKSAAYWLLDFASFIAFKEYYSKLQFPQTFNLLFSKEILKRDAKALTKLRET
LEVEIEIQQVLQYFFFSQFKALKRYANSAGIKIISDIPIFVSYDSADVWAHQKYFKLKFD
ASKDKVTGVPPGCLSRKEYLWDNAAYNWKALRKDDYVWWVNRIDFLRKYVDIIRIDYFRG
FVSTWEVAVEESPALSGRWVKCPGKDFFKHVLNEINNLEIWVEDLVKDRGDTFRLRDYFS
FPGTRVMQFAFDFDSNNLYLPHNYIRNCVVYTGSHENNTIREFVSSIDNKHKKYIFDYFN
TSEDAVVWDMIRGAMASVANSVIIPMKDYLDLIADFRMNMPDTMLDNFRILSSDLSVDLS
KKISNITKLYGRT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaaagtggaattttgctaaatattagttccctgccatctaagtatggtatt
ggtgatttaggaaagggggcatataaatttatagattttcttgtagcttcatcacaaagt
tattggcaaatattgccttattcaccttctaattttatagaatttccttattcaagttat
tctgcatttgctggtaatatcaattatattgatttaagtgctattgataggtttattgat
gtaagcttaagcactcttgagtgcttggaagatagatctattgattatgataagttaaaa
gctaaggaagttgttttaagaaatgctgctttgaattttttgcatagagcaacagttgat
gagatgcatgcatttgagaaatttaaaaaatccgctgcttactggcttttagattttgca
agttttattgcttttaaagagtattactctaagcttcaatttccacaaacttttaatctt
ttatttagtaaagaaatcttaaaaagagatgctaaggctttaactaagcttagagaaact
cttgaggttgagatagagattcaacaagttttacaatatttctttttttcacaatttaaa
gctttaaaaagatatgctaatagtgctgggattaaaataataagcgatattcccattttt
gtgtcttatgattctgctgatgtttgggcacatcaaaaatattttaagttaaagtttgat
gcaagtaaagataaggtaacgggcgtacctcctggttgcttgtctaggaaagaatatctt
tgggacaatgcagcttataattggaaggctttaagaaaagatgattatgtatggtgggtt
aatcgtattgattttctacgtaaatatgtagatattattagaatcgactattttagagga
tttgtatcaacttgggaggttgctgtagaagaatctccggcattgagtggacgatgggtg
aaatgtcccgggaaagatttttttaaacatgttctaaatgagattaataatttagaaatt
tgggtcgaagaccttgtaaaagatcgtggagatacatttaggttaagagattattttagt
tttcctggaactagggtaatgcaatttgcatttgattttgattctaataatctatatctt
ccccataattatataagaaattgtgttgtctatacaggtagtcatgagaataatactatt
cgtgaatttgttagttctattgataataagcataaaaaatatatttttgattatttcaat
actagtgaggatgctgttgtttgggatatgataagaggtgcaatggctagtgttgcaaat
agtgtaataattccaatgaaagattatcttgatttgatagctgattttaggatgaatatg
cctgatacaatgcttgacaattttaggatactgagtagtgatttgagtgttgatttaagc
aaaaagataagtaacattacaaaactttatggaagaacttaa

DBGET integrated database retrieval system