KEGG   Borrelia hermsii: BH0241Help
Entry
BH0241            CDS       T00764                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bhr  Borrelia hermsii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BH0241
Enzymes [BR:bhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BH0241
Exosome [BR:bhr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BH0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246280..247767
Genome map
AA seq 495 aa AA seqDB search
MKYILSLDQGTTSSRAVIFDKNANIKGFAKKEFKQIYPHPSWVEHDPNEIWGSLLGVMAE
ALANARTFPNNIEAIGITNQRETTIIWDRNTGHPIYNAIVWQDRRTAQLCDELKSKGKDK
IFLQKTGLVLDAYFSGTKIKWILDNVAGARKRAEKGELCFGTIDTWIVWNLTKGKIHITD
YSNASRTLLLNIKSLKWDCDLLQILDIPKSLLPELKQSSEVYGKTDASALGTEIIISGIA
GDQFAATFGQACLQKGMAKNTYGTGCFVTVNIGKKPIINEQKILTSIAWGRKNSITYVFE
GSVFIGGAVIQWLRDNLELFRKSGDAEAVAASVDNNGGIYFVPAFVGLGTPHWDPYARGM
IIGLTRSSTKEHITRAALESIALQSFDVLTEMQNSIQEFEIKELRVDGGASKNNLLMQFQ
ADILQCNVVRPKITETTALGSAYLAGLAVGYWESAEEITSLWKSDKIFEPSMEKSKREDL
IYNWNKAIKRAKAWI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattctatctcttgaccaaggcacaactagttcaagagcggtaatattcgat
aagaatgcaaacataaaaggatttgcaaaaaaggaatttaaacaaatttatccacatcca
agttgggttgagcacgatccaaacgaaatatggggctctctactaggagttatggcagaa
gctttagcaaacgcaagaacttttcccaataatattgaagcaattggaatcacaaatcaa
agagaaacgaccattatttgggataggaacacaggacatccaatttataacgcaatagtc
tggcaagacagaagaaccgcacaactttgtgatgaattaaaatcaaaaggaaaagataaa
atttttttacaaaaaacaggtcttgtattagatgcttactttagcggcacaaaaataaaa
tggatactggacaatgttgcaggagcaagaaaacgagcagaaaaaggggaactatgtttc
ggaacaatagatacttggatagtatggaaccttactaaaggaaaaatacatattacagat
tattctaacgcatcaagaactctacttttaaacattaaatcacttaaatgggactgtgat
ctattacaaatattagacatcccaaaatcacttttacctgaacttaaacaaagttccgag
gtgtatggcaaaaccgacgcttccgcactgggaacagaaatcattatttcaggaattgca
ggggatcaatttgcagcaacatttggacaagcatgtcttcaaaaaggaatggctaaaaat
acctatggaactggctgctttgtcactgtcaacataggaaaaaaacccatcataaatgaa
caaaaaattttaacgtcaattgcatggggaagaaaaaattcaataacttatgtttttgag
ggaagtgttttcattgggggagctgtaattcaatggttaagagacaatctagaactattt
agaaaaagcggtgatgcagaggcagtagcagcctcagtagataataatgggggcatttat
ttcgtgccagcatttgtaggacttggaacacctcattgggatccttatgccagaggaatg
attattggacttacaagaagctcaacaaaagaacatattacaagagcggctcttgaaagc
attgcattgcaaagctttgatgtactaaccgaaatgcaaaactctattcaagaatttgaa
ataaaggaattaagagttgatgggggagctagtaaaaataatctacttatgcaattccaa
gctgatattttacagtgcaatgttgtaaggcccaaaatcacagaaacgaccgctcttggt
tctgcctatctagcaggacttgctgttggatattgggaaagtgctgaagagattacaagt
ctttggaaatcagataaaatatttgaaccttcaatggaaaaaagtaaaagagaagattta
atctataattggaataaagctattaagagggcaaaagcttggatttaa

DBGET integrated database retrieval system