KEGG   Borrelia hermsii DAH: BH0415Help
Entry
BH0415            CDS       T00764                                 

Definition
(GenBank) protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bhr  Borrelia hermsii DAH
Pathway
bhr02020  Two-component system
bhr02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bhr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BH0415
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BH0415
Enzymes [BR:bhr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BH0415
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     BH0415
Two-component system [BR:bhr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BH0415
Bacterial motility proteins [BR:bhr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BH0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AAX16923
Position
428742..429890
Genome map
AA seq 382 aa AA seqDB search
MQKKIYVLVIEASSVNRKVISDIINSSLKLEVIATAANTDFALKKLKKHPDVILLSLETE
TIQEIAFIKKKQNINNNLPVIILSSNKDIAKNAILKGADDLIIKTNDKLESIKDKIIDLL
SVYGNKTIKNKIITNINSTFKTITNNRIEEDNLSTTEATDNNLIITKNKNETNNLHEEII
DEKALKKLKNRKFEIVVIGISTGGPAALKEILPEIPKNFPVPIIVVQHMPKEFTAEFARN
LNNICNLAVKETSNKEILQKGFIYISSGGYHTRINKINENYQIEVFDAANVNGHKPSIGV
LFKSISENVKEKAIALIMTGMGSDGSREIGDIKKAGGLTIAQDEQSSVVFGMPKIAIEEN
NVDYIVSISHVVKLLKAILIDG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaaatttatgtgctcgttattgaagcttcttctgttaatagaaaggttata
tcagacatcataaactcatctttaaaacttgaagttattgcaactgcagctaatacagac
tttgctcttaaaaaacttaaaaaacacccagatgtaatactactcagcttagaaacagaa
acaattcaagaaatcgctttcataaaaaaaaagcaaaatatcaataacaatctccctgtc
attatcctctcatcaaataaagatatagcaaaaaatgctatcttaaaaggtgctgacgac
ctcataataaaaaccaatgataaattagagagcataaaagataaaattattgatttactc
tcagtttacggaaacaaaactataaaaaataaaatcataactaacatcaactccacattc
aaaacaatcacgaataatagaatcgaagaagacaatctaagtacaacagaagcaacagat
aacaatttgataattacaaaaaataaaaatgagactaataaccttcatgaagaaataata
gatgaaaaggctttaaaaaaacttaaaaacagaaaatttgaaatagttgttattgggata
tctacaggaggccctgcagcactaaaggagatactaccagaaattcctaaaaactttcct
gtgccaataatagttgttcaacatatgccaaaagaatttacagcagaatttgcaagaaat
cttaacaatatttgcaacttagcagtcaaagaaacaagtaataaagaaatactccaaaaa
ggattcatatacataagttctgggggataccatacaagaattaataaaataaacgaaaac
tatcaaatagaagtctttgacgctgctaatgtaaacggacacaaaccctctataggcgta
ctatttaaatcaatatcagaaaatgtaaaagaaaaagcaatagctttaataatgactgga
atgggaagtgatggttctagagaaattggagacattaaaaaagctggtggactgactatt
gcacaagatgagcaaagttcagtggtttttggaatgccaaaaatagcaatagaagaaaat
aatgtagactatatagtttcaataagtcatgtggtaaaattattaaaagccatccttatt
gatggttaa

DBGET integrated database retrieval system