KEGG   Borrelia hermsii: BH0568Help
Entry
BH0568            CDS       T00764                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bhr  Borrelia hermsii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bhr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BH0568
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BH0568
Enzymes [BR:bhr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BH0568
Two-component system [BR:bhr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BH0568
Bacterial motility proteins [BR:bhr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BH0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589822..590973
Genome map
AA seq 383 aa AA seqDB search
MKILVIDIQGLIRQVFVRAFAKDMDIEVLNPGSNSLNLINIFLQKFPDLVIIVENTAKSH
FGLALNNVLNNISLPVVFIAEDEVYPKFGFLEPKKDKIKLIINKLNFKLTVNLFRSDYLN
LIKSEIKKLADNKFIASCETKRIKAPDFFAKSESEKSEGDIVGITKSYKVSDVINVAPKN
DPDVVLRYQGVINKNKTGKVIFVGSSTGGTEALRVFLKSFKKDSPPIVIVQHMPGGFTTS
FAKSLNNELEVDVKEAEDGDILRPGLVIIANGNYHLIVKYASGSYFVNLLDGPLVSRHKP
SVNVLFRSAAMYAGENAIGVMLTGMGDDGACCMLEMKRSGAYNIAQDQVTSVVFGMPMEA
IKIGAVDKVLPLNKISEYILRRS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattggtaattgatattcagggtcttataagacaggtttttgttagggctttt
gctaaggatatggatattgaggtattaaatccaggttctaattctttaaaccttattaat
atttttttacaaaaatttcctgatttggttattattgtcgagaatacggccaagtcgcat
tttggacttgcgcttaataatgttcttaataatatttcacttcctgttgtatttatagca
gaagatgaagtttatccaaagtttggatttcttgagcctaagaaagataaaattaaatta
ataataaataaacttaactttaaacttacagttaatttatttagaagtgattatttgaat
ttaataaaatctgagatcaaaaaactagctgataataaatttattgcttcttgtgagact
aaaaggataaaagctcctgatttttttgctaaatctgagagtgaaaaatctgagggtgat
attgttggtataacaaagagctataaggtttcagatgttattaatgttgcgcccaaaaat
gatccagacgttgttctaagataccaaggtgttattaataaaaataaaactgggaaagtt
atttttgttggttcttcaaccggtggtactgaggctttaagagtttttttaaagtctttt
aagaaagactcccctccaattgttatcgttcaacatatgccagggggatttacaacatct
tttgctaaaagtttgaataatgaacttgaagttgatgtaaaagaggctgaagatggagat
attttaaggcccggtcttgtaataattgcaaatggtaattatcatttaattgtgaaatat
gctagtgggagttattttgttaatctgttagatggtcctttagttagcagacataagcct
tctgttaatgtgttgttccgttctgctgctatgtatgccggggaaaatgctattggagtt
atgcttacgggaatgggggatgatggtgcttgttgcatgcttgagatgaagagaagtggt
gcatataacattgctcaagatcaagtaacatctgtagtatttggtatgcctatggaggca
ataaaaataggtgctgtagataaggtccttcctttaaataaaatatctgaatatatttta
aggagatcttaa

DBGET integrated database retrieval system