KEGG   Borrelia hermsii: BH0568Help
Entry
BH0568            CDS       T00764                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bhr  Borrelia hermsii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bhr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bhr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589822..590973
Genome map
AA seq 383 aa AA seqDB search
MKILVIDIQGLIRQVFVRAFAKDMDIEVLNPGSNSLNLINIFLQKFPDLVIIVENTAKSH
FGLALNNVLNNISLPVVFIAEDEVYPKFGFLEPKKDKIKLIINKLNFKLTVNLFRSDYLN
LIKSEIKKLADNKFIASCETKRIKAPDFFAKSESEKSEGDIVGITKSYKVSDVINVAPKN
DPDVVLRYQGVINKNKTGKVIFVGSSTGGTEALRVFLKSFKKDSPPIVIVQHMPGGFTTS
FAKSLNNELEVDVKEAEDGDILRPGLVIIANGNYHLIVKYASGSYFVNLLDGPLVSRHKP
SVNVLFRSAAMYAGENAIGVMLTGMGDDGACCMLEMKRSGAYNIAQDQVTSVVFGMPMEA
IKIGAVDKVLPLNKISEYILRRS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattggtaattgatattcagggtcttataagacaggtttttgttagggctttt
gctaaggatatggatattgaggtattaaatccaggttctaattctttaaaccttattaat
atttttttacaaaaatttcctgatttggttattattgtcgagaatacggccaagtcgcat
tttggacttgcgcttaataatgttcttaataatatttcacttcctgttgtatttatagca
gaagatgaagtttatccaaagtttggatttcttgagcctaagaaagataaaattaaatta
ataataaataaacttaactttaaacttacagttaatttatttagaagtgattatttgaat
ttaataaaatctgagatcaaaaaactagctgataataaatttattgcttcttgtgagact
aaaaggataaaagctcctgatttttttgctaaatctgagagtgaaaaatctgagggtgat
attgttggtataacaaagagctataaggtttcagatgttattaatgttgcgcccaaaaat
gatccagacgttgttctaagataccaaggtgttattaataaaaataaaactgggaaagtt
atttttgttggttcttcaaccggtggtactgaggctttaagagtttttttaaagtctttt
aagaaagactcccctccaattgttatcgttcaacatatgccagggggatttacaacatct
tttgctaaaagtttgaataatgaacttgaagttgatgtaaaagaggctgaagatggagat
attttaaggcccggtcttgtaataattgcaaatggtaattatcatttaattgtgaaatat
gctagtgggagttattttgttaatctgttagatggtcctttagttagcagacataagcct
tctgttaatgtgttgttccgttctgctgctatgtatgccggggaaaatgctattggagtt
atgcttacgggaatgggggatgatggtgcttgttgcatgcttgagatgaagagaagtggt
gcatataacattgctcaagatcaagtaacatctgtagtatttggtatgcctatggaggca
ataaaaataggtgctgtagataaggtccttcctttaaataaaatatctgaatatatttta
aggagatcttaa

DBGET integrated database retrieval system