KEGG   Borrelia hermsii HS1: BH0658Help
Entry
BH0658            CDS       T00764                                 

Definition
(GenBank) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bhr  Borrelia hermsii HS1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bhr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BH0658
   01230 Biosynthesis of amino acids
    BH0658
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH0658
  Energy metabolism
   00680 Methane metabolism
    BH0658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH0658
Enzymes [BR:bhr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BH0658
Exosome [BR:bhr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BH0658
  Exosomal proteins of melanoma cells
   BH0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
703816..704562
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNRENLFTGWTDVKLSEKGISEALEGGRVLKQNGYSFDIAFSSMLVR
ANDTLNIILRELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDQVLMWRRSYDIP
PMPLEESDKRHPIHDLRYKGIPKSELPSTECLKDTVARVIPYWTDKIAKAIIEGKRVIIA
AHGNSLRALVKYLDNMSDDDILKLNIPTGIPLVYELDQDLRPIKHYYLGDEDKIKAAMES
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtgaggcatggtgagagtgaatggaatagagaaaatcttttt
acaggctggactgatgttaagctttctgaaaagggtatttctgaagctttagagggtggt
agagttcttaaacaaaatggatattcttttgatattgcttttagttcaatgttagtcaga
gctaatgatactttaaatattattttgcgtgagttgggacaatcttatattgatgtagag
aaatcctggcgactcaatgagaggcattatggagctttgcaagggttaaataaggctgag
acagctgagaagtatggagaagatcaggttttaatgtggagacgtagttatgatattcct
cctatgcctttagaagagtctgataagcgtcatccaattcatgacttaagatataaagga
attcctaaaagtgagcttccctcaacagaatgtttaaaggatactgttgcaagagttata
ccgtattggacagataaaattgctaaagctattattgagggaaaaagagttattattgct
gctcatggtaattccttaagagctcttgttaaatatcttgataatatgagtgatgatgat
attttaaagctcaatattccgactggtattcctttagtttatgaacttgatcaagattta
agacctattaaacactattacttaggtgatgaggataagattaaggcggctatggaatct
gttgctaatcaaggaaagaaaaaataa

DBGET integrated database retrieval system