KEGG   Borrelia hermsii: BH0659Help
Entry
BH0659            CDS       T00764                                 

Gene name
lysK
Definition
lysyl-tRNA synthetase (EC:6.1.1.6)
Orthology
K04566  
lysyl-tRNA synthetase, class I [EC:6.1.1.6]
Organism
bhr  Borrelia hermsii
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bhr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(704645..706210)
Genome map
AA seq 521 aa AA seqDB search
MKTAHWADFYAKKIIEEKGEKEQYTVASGITPSGTVHIGNFREVISVDLVARALKDAGRN
VRFIYSWDNYDVFRKVPKNMPNQELLTTHLRQAITRVPDTQTNQSSYARANEVEFEKYLP
IVGIKPEFIDQSLKYMSSDYSSQIKFALDHKDEIEKVLNKYRTTKLADNWYPISIFCTKC
NRDTTTIKNYNHCYSIEYCCECGNKESLDLRKTWAVKLPWRIDWPMRWKYENVDFEPAGK
DHHSSGGSFDTSIEIVKIFGGTPPITFQYDFISIKGRGGKISSSSGDVVSLKDVLEIYTP
EVTRFLFASTKPNTEFSISFDLDVIKIYEDYDKFERVYYGIDDIKENKKEAFKRIYELSQ
PKLPDKEIPYQIGFRHLSTICQIFEGDKDKIFKLLNDVKESQKAKLINKIECAINWIKKF
APEDFKFSLRYTFDNIEPLKDNNKQGVTQLLDFLKKDFNNITEKEIQDEIYNIARNNNIE
PPLFFKQLYNILINKDKGPKLAGFIKIIGIKKFEEIVKHYI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagctcactgggcagatttttacgcaaaaaaaatcatagaagaaaagggagaa
aaagaacaatatacagttgcatcaggcatcactccatcaggaactgtacatattggaaac
tttagggaagtaatttccgttgaccttgtagcaagagcattaaaagatgcgggccgaaat
gtaagatttatctactcatgggataattatgatgtatttagaaaagtacctaagaacatg
cctaatcaagaattactgacaacccatttaagacaagcgatcacaagggttcctgatact
caaactaatcagtcaagctatgcaagagcaaacgaagtggaattcgaaaaatatttacct
attgtaggtatcaagccagaattcatagatcaaagtctaaaatacatgtcaagtgattat
tcaagtcaaattaagtttgcactagatcataaagatgaaatagaaaaagtgcttaataaa
tacagaacaacaaaacttgcagacaactggtaccctattagcattttttgcaccaaatgc
aacagagatactacaacaataaaaaattataatcactgctattctattgaatactgttgc
gaatgcggcaacaaggaatcgctcgatttaagaaaaacatgggctgtaaaacttccatgg
agaattgactggccaatgcgatggaaatatgaaaacgttgactttgagcctgcgggaaaa
gatcatcacagtagtggagggagctttgatacctcaatagaaattgtaaaaatttttggg
ggaactcctcccataacatttcagtatgatttcatatcaatcaagggacgtggtggaaaa
atatcctcatcatctggagatgtcgtgtcactaaaagatgtccttgaaatatacactcct
gaagttacaaggtttttatttgcatcaacaaagcccaacacagagttttcaatatcattc
gatcttgatgtaataaaaatatatgaagactatgataaatttgaaagagtatattatgga
attgatgacattaaagaaaacaaaaaagaagcttttaaaagaatttatgaactatctcaa
ccaaaattaccagacaaagaaattccctatcaaattggttttagacatttaagcacgatt
tgtcaaatttttgaaggcgataaagacaaaatttttaaacttttaaatgacgtcaaagaa
agccaaaaagcaaaacttataaacaaaattgaatgtgccattaactggatcaaaaaattt
gcacctgaagactttaaattttcactaaggtacacattcgataatatcgaacccttaaag
gataataacaaacaaggggtaacgcaattactagattttttaaaaaaagatttcaataat
atcactgaaaaagaaatccaagatgaaatttataatattgcaagaaacaataacattgag
cccccattattctttaaacaactttacaatatactaattaataaagacaagggaccaaaa
ttagcaggatttattaaaataattggaattaaaaaatttgaagaaatcgttaaacactat
atttag

DBGET integrated database retrieval system