KEGG   Borrelia hermsii: BH0669Help
Entry
BH0669            CDS       T00764                                 

Definition
chemotaxis protein CheA (EC:2.7.3.-)
Orthology
K03407  
two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
bhr  Borrelia hermsii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bhr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BH0669
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BH0669
Enzymes [BR:bhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BH0669
Protein kinases [BR:bhr01001]
 Histidine protein kinases
  CheA family [OT]
   BH0669
Two-component system [BR:bhr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BH0669
Bacterial motility proteins [BR:bhr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BH0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712829..715399
Genome map
AA seq 856 aa AA seqDB search
MLDSDSKELLEIFFEEAQNLVDTLEENIMSLEDDPNNAETIDEIFRAAHTLKGGSASVDM
MELSGFTHVVEDVFDAIRDNKLKICNDLVDLLLNALDVIKGMLDARLNGDVYLQDVSELK
NKLRGFLGDEHQTASVVSLENINDDEFLLSSRELSDMREVVGLEQKVLRVSIYFDQDNPM
ATIAGIQMFQALKDLGPILYTVPNYEQIIADKFLSRVDYYLISLNNRNVAEKIDLSDVAL
SYAIDEFDIGSELAKANSREKNAVVHDTVSKGELQLSNDELISLREHIGDAELFEVKLNF
NKDNPMATISGFQMLQALKSLGEVYKSIPDSEDLLTDKFFDSIVYYLISNTSVESISKKV
DLSDVVISFDIKKIDLEHIKDGDLNTEVESYTPVKEPKKPAVNVNLIRIDSKRIDSILNL
VSEAVISKSAYNQINSDITSFLYGFNHFYDYQESFRNSFLVDLKMIFKDVGLELESSLES
QIANLVEHKIDKTLQDMVGLRDLLLKILQDSRFASNRLSRIITDLHESVLKTRMLPVSGI
FSRFTRVVRDLSKKLGKVVELRTEGEDTEVDKSVIDDLVDPLMHCIRNSMDHGLETVDER
LSNGKDKTGHIVLRAKNEGNVISIEIEDDGRGIDPNIIRRKSIERGLIKENTVLSESEIL
NLIFEPGFSTASQITDVSGRGVGLDVVKSNVKKLNGNIIIDSKVNVGTTFKIKLPLTLVI
VQGLLVKSGSEIYVIPLNSVLETHRISEENIKFLENDHEVYNLREEVISVLRLDELFNIK
DDQTLYEKFLIVISINDKKAGIIVDSILGEEDFVVKPIKDKYASSPGIVGATTLGNGKVV
LIIDVFRLFDLKDMKG
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgctagattcagatagtaaagagcttttagagattttttttgaggaagctcagaatctt
gtagatactcttgaagagaatattatgtcattagaggatgaccctaataatgcagaaact
attgatgagatatttagggcggcacatactcttaagggcggttcagcttctgttgatatg
atggaactctcaggttttactcatgttgttgaggatgtatttgatgctattagagataat
aaattaaagatatgcaatgatcttgttgatttacttttaaatgcgcttgatgtaataaaa
ggcatgcttgatgcacgtcttaatggagatgtttatttacaagatgtaagcgagcttaaa
aataaattaagagggtttttaggagacgagcatcagacagcttctgttgtatctttagag
aatataaatgatgatgaatttttgctttcttcccgtgaacttagtgatatgcgcgaagtt
gtaggacttgagcaaaaggttttaagagttagtatttattttgatcaagataatcctatg
gctacaattgctggcatacaaatgtttcaggctttaaaagacttaggaccaattctttac
actgttcctaattatgagcaaattattgcagataagtttttaagcagagtagattattat
ttaatatctttaaataatcgtaatgttgcagaaaaaatagatttgtctgatgttgcctta
agttatgcaattgatgaatttgacattggtagtgaattggcaaaggcaaattcaagagag
aaaaatgctgttgttcatgatactgtatctaaaggcgaattgcagctttctaatgatgag
cttataagtttaagagagcatattggtgatgctgagttatttgaggtaaagttaaatttc
aataaagacaatcctatggcaacaatttctggatttcaaatgttgcaggcgttaaaaagt
ttaggtgaagtttataaatctattcctgatagtgaagatttattaaccgataagtttttt
gattctattgtatattatttaatatcaaatacctcagtggagagtatttctaaaaaggta
gatttatcagatgttgttattagttttgatattaagaaaatcgatttggagcatattaaa
gatggggatttaaatactgaagttgagagttatactcctgttaaggagccaaaaaagcca
gctgtgaatgtcaatttaattaggatcgatagtaaaaggatagattctatattaaatctt
gtaagtgaagctgttataagtaagtcagcttataatcaaataaattctgatataacatct
ttcctttatggttttaatcatttttatgattatcaagaaagttttcgcaatagtttcttg
gtagatttaaagatgatttttaaggatgtaggtttggaattggaaagttctcttgagagt
caaatagcaaatttggtggagcataaaattgataaaactttacaagatatggtaggttta
agagatttattgcttaaaattctccaagattctagatttgcttctaataggctctctagg
atcattactgatttgcatgagagtgttttaaagacaaggatgctaccagtttctggtatt
ttttcaagatttacaagagtggtaagagacctttcgaagaagctaggcaaagttgtagag
cttaggactgaaggggaggatacggaggttgataaatctgtcatagatgatcttgtagat
cctttaatgcattgtattaggaattctatggatcatggacttgagactgttgatgagaga
cttagcaatggtaaggataaaactggtcatatagttttgcgtgccaagaatgaaggtaat
gtgatatcaattgagattgaagatgatgggagaggtatagatccaaatattattaggcgg
aagtcaattgagaggggtttaataaaggaaaatacggttttatctgagagtgagattctt
aacttaatttttgaacctggattttcaacagctagtcaaattacagatgtttctggtaga
ggtgtaggacttgatgttgttaagagtaatgttaagaaattaaatggaaatattataata
gattcaaaggttaatgttggtactacttttaaaataaagcttcctttaacattagtgatt
gtgcagggccttcttgtaaaatcaggcagcgagatttatgttattcctttaaatagtgtt
cttgaaacgcatagaattagtgaggaaaatattaagtttcttgaaaatgatcatgaggtt
tataatttaagggaagaagttatatctgtgcttagactcgatgagctttttaatataaaa
gacgatcaaacattatatgagaagtttttgatagtcattagtattaatgataaaaaggca
gggatcattgtggattctattcttggagaagaagattttgttgtaaagcctattaaagat
aagtatgcgtcaagtcccggaatagttggagctactacacttggtaatggtaaggttgtc
ttaattattgatgtatttaggctttttgacctaaaggatatgaaaggatag

DBGET integrated database retrieval system