KEGG   Borrelia hermsii: BH0727Help
Entry
BH0727            CDS       T00764                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bhr  Borrelia hermsii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bhr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BH0727
   01230 Biosynthesis of amino acids
    BH0727
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH0727
   00030 Pentose phosphate pathway
    BH0727
   00051 Fructose and mannose metabolism
    BH0727
   00052 Galactose metabolism
    BH0727
  Energy metabolism
   00680 Methane metabolism
    BH0727
Enzymes [BR:bhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BH0727
Protein phosphatases and associated proteins [BR:bhr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BH0727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
772661..774004
Genome map
AA seq 447 aa AA seqDB search
MHRIRNENLDFKIENLGECKQDNPLISFYAKESHVHFTDETSKIRLNVYKNEEGWEQYEN
VFLEKAGPRYKIYFDPSHVKAAITTCGGLCPGFNDVIRSIVRTLWKVYGVYNIYGVKFGY
QGLLPESNLSFMKLNPDVVDDINQLGGTILGSSRGGIKPVEIVDTLERMEINMLFNIGGD
GTQKGSVLIAEEIERRNLKIAVVGIPKTIDNDLMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAYTALSSNDVNFCLIPELDFDIEGPNGLLAHLERRLLAK
ENLDEMPHAVILIAEGAGQKYFDPGSRKRDDSGNLLYEDIGLYIKDKVNTYFKSKNIPVN
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMAGKTKLLISLWSTKFVHIPIKMAVI
ARNKVNINGSFWRDVLSSTGQPFSMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcatagaattaggaatgagaatttagattttaaaatagaaaatttaggagaatgtaaa
caagataatcctttgattagtttttatgctaaggagagtcatgttcactttactgatgag
actagtaagattagattgaatgtttataaaaatgaagagggttgggagcaatatgagaat
gtttttttagagaaagctggtcctagatataagatttattttgatccaagtcatgttaag
gcggcaattactacttgtggaggtctttgtccaggttttaatgatgttattcgttcaatt
gttagaactttatggaaagtatatggagtttataatatttatggagttaaattcggatat
cagggacttttgccagagtctaatttgagttttatgaagctaaatcctgatgtagtagat
gatattaatcagcttggtgggacaatacttggttcatcaagaggggggattaaacctgtt
gaaatagttgatactttggagaggatggaaattaatatgctctttaatatcggtggagat
ggaacacaaaagggttctgttttaattgctgaggaaatagagagaagaaatttgaaaata
gctgttgtaggtattccaaagacaatagataatgatttgatgtttgttcaaaaatctttt
ggatttgaaacggctgtggagcaagcagttgctgcggttgctggtgctcactttgaggca
aatagtgcttataatggaattggtcttgttaaggttatgggtagagattctgggtttatt
gctgcttatactgctttatcatctaatgatgttaatttttgtttaatcccagaactagat
tttgatattgaggggcctaatgggcttcttgcacatcttgaaagacgccttttggcaaaa
gagaatttggatgagatgccccatgcagtaatattaatagcagagggagctggacaaaaa
tattttgatcctggtagtcgcaaaagagatgattctggtaatttgctttatgaagatatt
ggactttatattaaagacaaggttaatacgtattttaaatcaaaaaatattccagttaat
cttaaatatattgatcctagttatattattagaagctcaccagctaatgctagtgattcc
ctttattgtgctcgtcttggctcaaatgctgttcatgctgctatggcaggtaagacaaaa
ttattaattagcttatggagtacaaaatttgtacatattccaataaaaatggcagtaatt
gctagaaataaagtcaatataaatggttctttctggcgggatgttctttcaagtactggt
cagccatttagcatgaagaactaa

DBGET integrated database retrieval system