KEGG   Brachyspira hyodysenteriae: BHWA1_00046Help
Entry
BHWA1_00046       CDS       T00865                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bhy00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bhy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42488..43567)
Genome map
AA seq 359 aa AA seqDB search
MRNFISIKELSKEEVIEVLDVAKELDNADSKERRKIMDGMIMTSIFFEPSTRTRLSFTSA
AYRLGCKELGFDNPEQSSVKKGESLRDTIIMVSAYSDIIVMRHSIDGAAKFAEEVTNCPI
INAGDGANEHPSQTLLDLYTLREELGTIENQKVAFVGDTRYGRTVHSLVDGLMMFNGQFY
FISPDVIQIPDYILKELDNANIKYKKLSNYEEVLKEIDCLYMTRVQRERFDDINEYEEVK
HAFRISKDNIVGKCKDDMIILHPLPRVDEINIDLDDTKYAKYFIQARNGVPTRMAMMALA
TDAIKSKVKRKEMNYEVVENKEVVCPNNKCVTHFEETKNRVVKKGYGDFCYYCNREIGK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactttatatctatcaaagagttatcaaaagaggaagttattgaagtattagat
gttgctaaggagttggataacgctgatagtaaagaaagaagaaagattatggacggaatg
ataatgacaagtatattcttcgaaccttctacaaggacaagattatcattcacatccgct
gcttataggttgggatgtaaagaattaggattcgacaaccctgaacaaagctctgtaaaa
aaaggagaatctttgagagatactataattatggtttctgcatattcagatattatagtt
atgaggcatagtattgacggagctgctaaatttgctgaagaggttacaaactgtcctatt
ataaacgccggagacggtgctaacgaacaccctagtcaaactttattggatttatacaca
ttaagagaagaattaggaactatagagaatcaaaaagttgcttttgtaggagatacaaga
tatggaagaacagttcactctttagttgatggtttaatgatgtttaatggtcagttctat
tttatatctcctgatgttatacaaatacctgattatatattaaaagaattagataatgcc
aatataaaatataaaaaacttagtaattatgaagaagtattaaaagaaatagactgtcta
tatatgactagagtacaaagggaaagatttgatgatatcaatgaatatgaagaagtaaaa
catgcatttagaatatcaaaagacaatattgttggaaaatgtaaagatgatatgataata
cttcaccctctcccaagagttgatgaaattaatatagacttagatgatacaaaatatgct
aaatattttattcaagctagaaacggcgttcctacaagaatggctatgatggctttggct
acagatgctataaaatctaaggtaaaaagaaaagaaatgaattacgaagttgttgaaaat
aaagaagtagtttgtcctaataataaatgcgttacacattttgaagagacaaaaaataga
gttgtaaaaaaaggttatggagatttctgctattactgtaacagagaaataggaaaataa

DBGET integrated database retrieval system