KEGG   Brachyspira hyodysenteriae WA1: BHWA1_00476Help
Entry
BHWA1_00476       CDS       T00865                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00900  Terpenoid backbone biosynthesis
bhy01100  Metabolic pathways
bhy01110  Biosynthesis of secondary metabolites
bhy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BHWA1_00476 (dxr)
Enzymes [BR:bhy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BHWA1_00476 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: ACN82972
UniProt: C0QYN4
Position
complement(566543..567697)
Genome map
AA seq 384 aa AA seqDB search
MKKRILLLGATGSIGLNTYSVVCKFRNEFEIVGMSTNSKIDILSNLCDDLKPKTVNISDK
IAENIFKDYDCAKDLSIYEGTIADFVKDTDFDILVNALTGYAGFLPTVEAIKKGKTIALA
NKETLVVGGDIINQLLKEYKASLIPIDSEHSAIFQMLRHFPKESLSKVIITASGGPFFRT
PKEELKNVTVEMALKHPTWSMGNKITIDSATMMNKGFEVIEAHHLFNLDYDKIETIIHPQ
SLIHSMIEMNDGEIYAQIGKNDMRLPIQHALTYPEIRNTPFEKLKLYEHPEINFYKMDFD
KFVMLRLAYECGKKGGLYPCVLNASNEICVYSFLQKKIGFTDIFDIVSKVCDRKINVPLT
IDNIINMDSEIRKETAWIINSMSK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaattcttttattgggagctactggctctataggtttgaatacttattcc
gttgtttgtaaatttagaaatgagtttgaaatagtaggaatgtctacaaatagcaaaata
gatatattaagtaatttatgtgatgatcttaaacctaaaactgtaaatatatcagataag
attgctgaaaatatttttaaagactatgactgcgcaaaagatctaagtatatatgaggga
actatagctgattttgtaaaagatactgattttgatatattagttaatgcacttacagga
tatgcaggatttttgcctactgtagaagcaataaaaaaaggaaaaactattgctttggca
aataaagaaacattagtcgtaggcggagatataataaatcaattattgaaagaatataaa
gcaagcttaatacctatagacagtgaacattctgctatatttcagatgttaaggcatttt
cctaaagagtctctttcaaaagtaataataacagcttctggaggaccttttttcagaact
ccaaaagaagaattaaaaaatgttacggttgaaatggctttaaaacaccctacatggtct
atgggaaataaaataacaatagacagtgctactatgatgaataagggctttgaagttata
gaggctcatcatttatttaatttggattatgataaaatagaaacaatcattcaccctcaa
agtttaatacattctatgatagaaatgaatgacggagaaatttatgcacagatcggcaaa
aatgatatgcgtcttcctatacagcatgcattaacttatcctgaaattagaaacacccct
tttgaaaaattaaaattatatgaacatccagaaatcaatttttataaaatggactttgat
aaatttgtaatgcttagattggcttatgaatgtggaaagaaaggcggactttatccttgt
gttttaaatgcctctaatgaaatatgtgtgtattcattcttacaaaagaaaataggtttc
actgatatatttgatattgtatcaaaagtatgcgacagaaaaattaatgttccattaact
atagataatattattaatatggatagtgaaataagaaaagaaacagcttggataattaat
tcaatgtctaaataa

DBGET integrated database retrieval system