KEGG   Brachyspira hyodysenteriae: BHWA1_00493Help
Entry
BHWA1_00493       CDS       T00865                                 

Gene name
cheB
Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bhy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bhy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584178..585311
Genome map
AA seq 377 aa AA seqDB search
MATKIKVLAIDDSALIRQLLTKIVNSDPALEMVGTAANPILAENKVKNLKPDIITLDIEM
PEMDGITYLKKLMLNNPIPVIMFSSLLDKHRELALDALNIGAFDYVIKPSANVRDGVEEL
ATDLVEKIKNAYANRAKFYRKHGVNVPTEPAAATERSSISLEAPKTAGFKVYQKNTADII
LPLTPSRETPMDKIILIGSSTGGTEALIECLKNVTPSAPPIVIAQHMPEHFTTSFAKRLN
SILKIDVFESEDGMSIGRGQAVLARGAKHTMIKVRGGKYYIEVRDGEPVTRHKPSVDVLF
RSGAVYAKNKAIGIILTGMGDDGANGMKEMKDAGAYNIAQNEETCTVFGMPREAIARGGV
DEVLPLDKILAAALKRV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaaaattaaagtattagctattgacgatagcgcattaataagacaattactt
actaaaattgtaaattcagatcctgctttggaaatggtgggaactgctgcaaatccaatt
ttagctgaaaataaggtcaaaaatcttaagcctgacattattactttagatattgaaatg
ccggaaatggatggtattacatatcttaaaaagcttatgcttaataatcctattcctgta
ataatgtttagctcgcttttagataaacatagagaattagctttagatgctttaaatatt
ggagcttttgattatgtaataaaaccttccgcaaacgttagagatggtgtagaagaatta
gctacagacttagttgaaaaaataaagaatgcttatgcaaacagagctaagttttataga
aaacatggtgttaatgttccaacagaacctgctgcagctacagaaagaagttctattagt
ttagaagcaccaaaaaccgctggttttaaagtttatcaaaaaaatactgccgatattata
cttcctcttacaccttcaagagaaactcctatggataaaataattcttataggttcatca
acaggcggtacagaggctttaatagaatgtcttaaaaatgttaccccttctgctcctcct
atagttattgctcagcacatgcctgaacactttactacttcatttgctaaaagattaaat
agtattcttaaaatcgatgtatttgaatctgaagatggtatgagtataggaagaggacaa
gctgtactagcaagaggtgctaaacatactatgattaaagttagaggcggtaagtattat
atagaagtaagagacggagaacctgttacaagacataaaccttctgtagatgtacttttc
agaagcggtgctgtatatgctaaaaacaaagctataggtataatacttacaggtatgggt
gatgatggtgctaatggtatgaaagaaatgaaagatgccggtgcttacaatatagctcag
aacgaagaaacttgtactgtttttggaatgcctagagaagcaattgcaagaggcggtgtt
gatgaagttttaccattagataaaatacttgctgctgctctaaaaagagtataa

DBGET integrated database retrieval system