KEGG   Brachyspira hyodysenteriae WA1: BHWA1_00611Help
Entry
BHWA1_00611       CDS       T00865                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00260  Glycine, serine and threonine metabolism
bhy00750  Vitamin B6 metabolism
bhy01100  Metabolic pathways
bhy01110  Biosynthesis of secondary metabolites
bhy01120  Microbial metabolism in diverse environments
bhy01230  Biosynthesis of amino acids
Module
bhy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BHWA1_00611 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BHWA1_00611 (thrC)
Enzymes [BR:bhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BHWA1_00611 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ACN83107
UniProt: C0QZ19
Position
complement(733108..734163)
Genome map
AA seq 351 aa AA seqDB search
MKSWKGLLREYRKYLPITNKTPLITLHEGNTPLIKAERIGRDLDIELYLKYDGLNPTGSF
KDRGMVMAVAKALEGRDTKAIMCASTGNTSASAAAYAARSGIDCIVVIPDGNIALGKLAQ
ALMYGAKVIAIKGNFDEALKAVVDITNKYPITLVNSINPFRLQGQKTSAFEICDVLGKAP
DYLAIPVGNAGNISAYWMGFKEYKENAKINNLPKMIGFEAEGSAAIVQNKIIENPQTLAT
AIKIGNPASWKLAVNAANESEGFIDSVTDDEILEAYKMLTTEEGVFAEPASAASLAGIIK
SRKAGKINKGDTVVSVLTGNGLKDPDNAIKICNEPIKVDNNIEEIRKAIGI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttggaaaggacttttaagagaatacagaaaatatttacctattacaaataaa
actccattgataaccttgcatgaaggaaatactcctttaataaaagctgaaagaatagga
agagatttggatatagaattatatttaaaatatgacggacttaatcctacaggttctttt
aaagacagaggtatggtaatggctgttgctaaagcacttgagggcagagatactaaagct
ataatgtgtgcttctacaggaaatacttctgcatctgctgctgcttatgctgctagaagc
ggtatagactgtatagttgttatacctgatggaaatattgctttaggtaaattagcccag
gctttgatgtatggtgctaaagttatagctattaaaggaaattttgatgaggctttaaag
gctgttgttgatattactaataaatatcctattacattggtaaactctattaatcctttc
agacttcagggacaaaaaacttctgcatttgaaatttgcgatgttttaggaaaagcccct
gattatttggcaatacctgttggaaatgcaggaaatatatctgcatattggatgggtttt
aaagaatataaagaaaatgcaaagataaataatcttccaaagatgataggttttgaggct
gaaggttctgctgctatagtacaaaacaaaataatagagaatcctcagacattagctact
gctataaaaataggaaatcctgcaagctggaaacttgctgttaatgctgctaatgaatct
gaaggctttattgattctgttactgatgatgagatattagaggcttataaaatgcttaca
acagaagaaggtgtatttgctgagcctgcttctgctgcttctcttgctggtataataaag
agccgtaaagctggaaaaataaataaaggtgatactgtagtttctgtattaacaggaaac
gggcttaaagatcctgataatgcaataaaaatttgcaatgaacctataaaagttgataac
aatatagaagaaataagaaaagctataggaatatga

DBGET integrated database retrieval system