KEGG   Brachyspira hyodysenteriae: BHWA1_00611Help
Entry
BHWA1_00611       CDS       T00865                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bhy01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bhy00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bhy00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(733108..734163)
Genome map
AA seq 351 aa AA seqDB search
MKSWKGLLREYRKYLPITNKTPLITLHEGNTPLIKAERIGRDLDIELYLKYDGLNPTGSF
KDRGMVMAVAKALEGRDTKAIMCASTGNTSASAAAYAARSGIDCIVVIPDGNIALGKLAQ
ALMYGAKVIAIKGNFDEALKAVVDITNKYPITLVNSINPFRLQGQKTSAFEICDVLGKAP
DYLAIPVGNAGNISAYWMGFKEYKENAKINNLPKMIGFEAEGSAAIVQNKIIENPQTLAT
AIKIGNPASWKLAVNAANESEGFIDSVTDDEILEAYKMLTTEEGVFAEPASAASLAGIIK
SRKAGKINKGDTVVSVLTGNGLKDPDNAIKICNEPIKVDNNIEEIRKAIGI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttggaaaggacttttaagagaatacagaaaatatttacctattacaaataaa
actccattgataaccttgcatgaaggaaatactcctttaataaaagctgaaagaatagga
agagatttggatatagaattatatttaaaatatgacggacttaatcctacaggttctttt
aaagacagaggtatggtaatggctgttgctaaagcacttgagggcagagatactaaagct
ataatgtgtgcttctacaggaaatacttctgcatctgctgctgcttatgctgctagaagc
ggtatagactgtatagttgttatacctgatggaaatattgctttaggtaaattagcccag
gctttgatgtatggtgctaaagttatagctattaaaggaaattttgatgaggctttaaag
gctgttgttgatattactaataaatatcctattacattggtaaactctattaatcctttc
agacttcagggacaaaaaacttctgcatttgaaatttgcgatgttttaggaaaagcccct
gattatttggcaatacctgttggaaatgcaggaaatatatctgcatattggatgggtttt
aaagaatataaagaaaatgcaaagataaataatcttccaaagatgataggttttgaggct
gaaggttctgctgctatagtacaaaacaaaataatagagaatcctcagacattagctact
gctataaaaataggaaatcctgcaagctggaaacttgctgttaatgctgctaatgaatct
gaaggctttattgattctgttactgatgatgagatattagaggcttataaaatgcttaca
acagaagaaggtgtatttgctgagcctgcttctgctgcttctcttgctggtataataaag
agccgtaaagctggaaaaataaataaaggtgatactgtagtttctgtattaacaggaaac
gggcttaaagatcctgataatgcaataaaaatttgcaatgaacctataaaagttgataac
aatatagaagaaataagaaaagctataggaatatga

DBGET integrated database retrieval system