KEGG   Brachyspira hyodysenteriae WA1: BHWA1_00673Help
Entry
BHWA1_00673       CDS       T00865                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00230  Purine metabolism
bhy01100  Metabolic pathways
Module
bhy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BHWA1_00673 (gmk)
Enzymes [BR:bhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BHWA1_00673 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 ATPase_2 AAA_22 MMR_HSR1 DNA_pol_B_3 MobB Roc AAA_14 AAA_33 AAA_24 RsgA_GTPase AAA_16 AAA_30
Motif
Other DBs
NCBI-ProteinID: ACN83167
UniProt: C0QZ79
Position
complement(802842..803393)
Genome map
AA seq 183 aa AA seqDB search
MSNIVVITAPSAAGKTTLIKKYMANHSNAVFSVSHTTRTKRANEIDGKDYYFVDKEKFEE
MISEGDFIEWALVHDNYYGTSFKELEKADDENNILILDIDIQGALYIKNKGIEANYIFIT
PPSMEILKKRLEDRGTETEESIKLRIWDAKRELEYKDKFDIIIENDDVEEAYKKLEEAIN
SKL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgttgttattacagccccttcggcagccggcaaaactactttgataaaa
aagtatatggctaatcattctaacgcagtttttagtgtttcgcataccactagaactaaa
agagcaaatgaaatagacggtaaggactattattttgtagataaagaaaaatttgaggaa
atgatatcagaaggcgattttatagaatgggcattagttcatgataattattatggaact
tctttcaaagaattagaaaaagctgatgatgaaaataatattttgatacttgatatagac
attcaaggcgccttatatataaaaaacaagggaatagaggctaattatatatttataact
cctccttctatggaaattctaaaaaaaagacttgaagatagaggaactgaaacagaagaa
agtataaaacttagaatttgggatgccaaaagagaattagaatataaagataaattcgat
atcattatagaaaatgatgatgttgaagaagcttataaaaaattagaagaagcaatcaat
tcaaaattataa

DBGET integrated database retrieval system