KEGG   Brachyspira hyodysenteriae WA1: BHWA1_00686Help
Entry
BHWA1_00686       CDS       T00865                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00330  Arginine and proline metabolism
bhy00332  Carbapenem biosynthesis
bhy01100  Metabolic pathways
bhy01130  Biosynthesis of antibiotics
bhy01230  Biosynthesis of amino acids
Module
bhy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BHWA1_00686 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BHWA1_00686 (proB)
Enzymes [BR:bhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BHWA1_00686 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA PrmA SH3_2
Motif
Other DBs
NCBI-ProteinID: ACN83180
UniProt: C0QZ92
Position
814729..815874
Genome map
AA seq 381 aa AA seqDB search
MKNIDLNNVNRIVFKFGTNVLRNDEGYISLARIYSFIEAIAKFHRMGKEVLIVTSGAVGL
GAKKINVTDLDEVALKQACAAIGQSQLMSIYEDGFSKFDIVTAQILLTEEDFSNRRRYLN
LHSTLSMLLKYKVVPIINENDTVSSDELKQLYDVTQISFSDNDKLSALVASELDADLLII
LSDINGLYDDNPKTNPNAKFIHEVFEVTKEIENLGLDASKGGRGGMKTKLQAAKIVTRSG
CALFIANGKRPNVLNDIFETKDKTIFYPVEEDNELSTKRRWIAYATTIIGKLIVNAGAKK
AVLEKESSLLPIGITKVINNFKKGDIVSIIDENGTEFARGIVNYNSDDVQKIIGHHSDDI
LKILGYKNYDAVITRDYIVLL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagatttaaataatgtaaatagaatagtattcaaattcggtacgaatgtt
ttgaggaatgatgaaggatatatatctttagctagaatatattcgtttatagaagctata
gcaaagtttcacagaatgggaaaagaagttttaatagttacttcaggagctgtgggatta
ggtgctaaaaaaattaatgtaacagatttagatgaagttgctttgaaacaggcttgtgct
gccatagggcaatctcagcttatgtctatatatgaagacggattttcaaaattcgatata
gttactgctcaaatacttttaactgaagaagatttctcaaatagaagaagatatttaaat
ttgcactctactttgagtatgcttttaaaatataaagttgtgcctataataaatgaaaat
gatacagtatcaagcgatgagcttaaacaattatacgatgttactcaaataagtttttca
gataatgataaactttcagcattagtagcaagcgaattagatgctgatttacttataata
ctttcagatataaatgggctttatgatgataatcctaaaactaaccctaatgctaaattt
atacatgaagtatttgaagttacaaaagaaatagagaatctaggtcttgatgcttcaaaa
ggcggaagaggcggaatgaaaacaaagcttcaggctgcaaaaatagttacaagatcagga
tgtgcattgtttatagctaatggaaaaagacctaatgttctcaatgatatttttgagaca
aaagataaaacaatattctatcccgttgaagaagataatgaactttcaactaaaagaaga
tggattgcttatgctacaactataataggaaaattaatagttaatgcaggagctaaaaag
gctgttttagaaaaagaatcaagtcttttgcctataggaataacaaaagtaattaataac
tttaaaaaaggcgatatagtaagtataatagatgaaaatggtacagagtttgcaagggga
atagttaattataattctgatgatgttcagaaaataataggacatcactctgatgatata
cttaaaatattaggctataaaaattatgatgctgttattaccagagactatatagtatta
ttataa

DBGET integrated database retrieval system