KEGG   Brachyspira hyodysenteriae: BHWA1_00758Help
Entry
BHWA1_00758       CDS       T00865                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bhy00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(904044..904706)
Genome map
AA seq 220 aa AA seqDB search
MSDNRIDLGQQIIDACLNMRKDGVNQGTSGNISLRYKDGMLITPTSMPYEIMTPDDIVFV
DGNGNPEPNKKPSSEWRFHLSILKDNPSFNAVIHNHAVYSSMVSILNVDCIPAIHYMVGV
AGGKIIPCAEYATYGTQELCDNISKVMKGYKACILKNHGLLAADETLEKAYHVMMEVENL
ARLYIGVRSIGDYKVLSDSEMDIVLAKFNNYGLNVEHKNK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataatagaatagatttaggtcagcaaattatagatgcttgtttaaatatgaga
aaagacggtgttaatcaaggcacatcaggaaatataagtttaagatataaagatggtatg
cttatcactccaacaagtatgccttatgagattatgactccagatgatattgtttttgta
gacggaaatggaaatccagaaccaaataaaaaaccttcaagtgaatggagatttcattta
tcaatacttaaagataatcctagttttaatgctgtaatacacaatcatgctgtttattct
tctatggtttctattttgaatgtagactgcatacctgctatacattatatggttggagtt
gcaggaggaaaaataattccttgtgctgaatatgctacttatggtactcaggaattatgc
gacaatatttcaaaagttatgaaaggttataaggcttgcatattaaaaaatcatggactt
cttgctgctgatgaaactttggaaaaggcttatcatgttatgatggaagttgagaattta
gctagattgtatattggtgttagaagtattggtgattataaggttctatctgatagcgag
atggatatagttttagctaagtttaataattacgggcttaatgtggagcataaaaataaa
tag

DBGET integrated database retrieval system