KEGG   Brachyspira hyodysenteriae WA1: BHWA1_00758Help
Entry
BHWA1_00758       CDS       T00865                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00051  Fructose and mannose metabolism
bhy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BHWA1_00758 (fucA)
Enzymes [BR:bhy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BHWA1_00758 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACN83251
UniProt: C0QZG3
Position
complement(904044..904706)
Genome map
AA seq 220 aa AA seqDB search
MSDNRIDLGQQIIDACLNMRKDGVNQGTSGNISLRYKDGMLITPTSMPYEIMTPDDIVFV
DGNGNPEPNKKPSSEWRFHLSILKDNPSFNAVIHNHAVYSSMVSILNVDCIPAIHYMVGV
AGGKIIPCAEYATYGTQELCDNISKVMKGYKACILKNHGLLAADETLEKAYHVMMEVENL
ARLYIGVRSIGDYKVLSDSEMDIVLAKFNNYGLNVEHKNK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataatagaatagatttaggtcagcaaattatagatgcttgtttaaatatgaga
aaagacggtgttaatcaaggcacatcaggaaatataagtttaagatataaagatggtatg
cttatcactccaacaagtatgccttatgagattatgactccagatgatattgtttttgta
gacggaaatggaaatccagaaccaaataaaaaaccttcaagtgaatggagatttcattta
tcaatacttaaagataatcctagttttaatgctgtaatacacaatcatgctgtttattct
tctatggtttctattttgaatgtagactgcatacctgctatacattatatggttggagtt
gcaggaggaaaaataattccttgtgctgaatatgctacttatggtactcaggaattatgc
gacaatatttcaaaagttatgaaaggttataaggcttgcatattaaaaaatcatggactt
cttgctgctgatgaaactttggaaaaggcttatcatgttatgatggaagttgagaattta
gctagattgtatattggtgttagaagtattggtgattataaggttctatctgatagcgag
atggatatagttttagctaagtttaataattacgggcttaatgtggagcataaaaataaa
tag

DBGET integrated database retrieval system