KEGG   Brachyspira hyodysenteriae: BHWA1_00772Help
Entry
BHWA1_00772       CDS       T00865                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BHWA1_00772 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BHWA1_00772 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BHWA1_00772 (trpB)
Enzymes [BR:bhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BHWA1_00772 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
920493..921746
Genome map
AA seq 417 aa AA seqDB search
MKNSNKGFFGKFGGRFVPEALEKLLIELEEAFLHYINDKEFLSELEELRADFIGRPTPLM
YAKNLSEKIGGAKIYVKLEGLAHTGAHKINNSIGQALLAKKMGKKKIIAETGAGQHGLAT
AAACAKLGLECSIYMGEIDVKRQQPNVASMELYGANVVSVTKGGRGLKDAVDMALEDWVK
DLKDTHYLLGSAVGPSPYPDIVRTFQSVIGRELDKQIQEKNLNVKALIACVGGGSNAIGF
FEPFIERENPKLIAVEAGGISMNLGENAIRMQNPYAKDVAAQGYMSKFILKENGEISETM
SISAGLDYPGVGPQLAYLGESGRIEFTYATDKEAINAVKEFASHEGVIFALESAHAGAKA
IEYAKQYSKDDVIIVNMSGRGDKDIFITSPIFRPNKWKEFLKSELERLEKNIDIHKF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagtaataaaggttttttcggtaaattcggaggaagatttgtaccggaagca
ttggaaaaattattaatcgaattggaagaggctttcttgcattatatcaatgataaagaa
tttctaagcgaacttgaagaattaagagctgattttataggaagacctactccattaatg
tacgctaaaaatttgtcagaaaagattggaggggctaagatatatgtaaaattagaaggt
cttgctcatacaggtgcacataagattaataattctatagggcaggcattgcttgctaaa
aaaatgggcaagaaaaaaattattgcagaaaccggagctggtcagcatggacttgcaact
gctgccgcctgtgcaaaattaggacttgaatgctccatttatatgggtgaaatcgatgtg
aaaagacagcagcctaatgtggcttctatggaattatacggagctaatgtggtatccgtt
actaaaggaggaagaggacttaaagatgctgttgatatggcattggaagattgggttaaa
gatttaaaagatacacattatttacttggaagcgctgtaggtcctagcccttatcctgat
attgtaaggacttttcaatctgtaataggaagagaattagataaacaaatacaagaaaaa
aatttaaatgttaaagccttgatagcatgtgtaggcggcggttctaatgctataggattt
ttcgagccttttatagaaagagaaaatcctaaattaatagctgtagaagcaggcggaata
agtatgaatctaggagagaatgctattagaatgcaaaatccttatgctaaagatgttgca
gctcagggatatatgagtaaattcattctaaaagaaaatggtgaaatatctgaaactatg
tcaatatctgctggattagattatcctggagttggtcctcagcttgcatatttaggtgaa
tcaggaagaatagagttcacttatgccactgataaagaagcaataaatgctgtaaaagaa
tttgctagtcatgaaggtgttatatttgcattagaaagtgcccatgctggtgctaaggct
atagaatatgccaagcaatatagtaaagatgatgttattatagttaatatgtcaggaaga
ggagataaagatatattcataacttcacctatatttagacctaataaatggaaagaattc
ttaaaaagtgaattagaaagattagagaaaaacatagatattcacaaattttaa

DBGET integrated database retrieval system