KEGG   Brachyspira hyodysenteriae: BHWA1_00995Help
Entry
BHWA1_00995       CDS       T00865                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bhy00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bhy00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1163062..1163418)
Genome map
AA seq 118 aa AA seqDB search
MQDLYKKYKKEGFEILDFPCNQFGGQAKEPIEEIAEFRKEKYGITFKLFDKVKVNSKNAD
PLFTYLRTEKPTEEGVDKIRWNFGKFLIDRQGNIVGRYDPRVKPEELDEIVAELLKKE
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggatttatacaaaaaatacaaaaaggaaggttttgaaatattagacttcccttgt
aatcaattcggcggacaggctaaagaacctattgaagaaattgctgagtttagaaaggag
aaatacggcattactttcaagctatttgacaaagttaaagttaatagcaagaatgctgat
cctttatttacttatttaagaacagaaaagcctactgaagaaggcgttgataaaataaga
tggaatttcggtaagtttttaatagacaggcaaggaaatatagttggacgctatgatcct
agagtaaagcctgaagaacttgatgagatagtagccgaattattaaaaaaagaataa

DBGET integrated database retrieval system