KEGG   Brachyspira hyodysenteriae: BHWA1_00995Help
Entry
BHWA1_00995       CDS       T00865                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BHWA1_00995 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BHWA1_00995 (bsaA)
Enzymes [BR:bhy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BHWA1_00995 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1163062..1163418)
Genome map
AA seq 118 aa AA seqDB search
MQDLYKKYKKEGFEILDFPCNQFGGQAKEPIEEIAEFRKEKYGITFKLFDKVKVNSKNAD
PLFTYLRTEKPTEEGVDKIRWNFGKFLIDRQGNIVGRYDPRVKPEELDEIVAELLKKE
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggatttatacaaaaaatacaaaaaggaaggttttgaaatattagacttcccttgt
aatcaattcggcggacaggctaaagaacctattgaagaaattgctgagtttagaaaggag
aaatacggcattactttcaagctatttgacaaagttaaagttaatagcaagaatgctgat
cctttatttacttatttaagaacagaaaagcctactgaagaaggcgttgataaaataaga
tggaatttcggtaagtttttaatagacaggcaaggaaatatagttggacgctatgatcct
agagtaaagcctgaagaacttgatgagatagtagccgaattattaaaaaaagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system