KEGG   Brachyspira hyodysenteriae WA1: BHWA1_01142Help
Entry
BHWA1_01142       CDS       T00865                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00052  Galactose metabolism
bhy00561  Glycerolipid metabolism
bhy00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BHWA1_01142
  Lipid metabolism
   00561 Glycerolipid metabolism
    BHWA1_01142
   00600 Sphingolipid metabolism
    BHWA1_01142
Enzymes [BR:bhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BHWA1_01142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ACN83622
UniProt: C0R0I4
Position
complement(1319279..1320619)
Genome map
AA seq 446 aa AA seqDB search
MGAGSAQFGCDMLGDIFSTKSLEGSHITLLDINTNALNKVYDYVKEFIESNKLNFIVDAL
TDRKKAFKDADFIISSIEVGDRFQLWDEDWKIPMQYGIHQVYGENGGPGGVFHSLRIIPP
ILDIVKDAMDICPNAYIFNFSNPMTAICTAVKRAYPNAKFIGLCHEIGWLHKWLPKILRM
NYESLDIKAGGLNHFSCLLEIKDKKTGKDLYPDVLKNAHGYFEHEVGYSDLLKYAKANNA
FSKTENFDHSIEERLKGEFIWADRRLLKVILEKYKLLPITVDSHFGEYIAWAWDVVDHRG
ILDFYELYRTVLSKAEPKIELIVKERASSIINAIVTNESYVEEAVNILNDGLIEDLPNWI
AVEVPAEISKDGVKGVKLNNVPKGYLSLLRNYVSVYDLTAEAAIHHKKEYAVQAILANPV
VNVCKNIEEMVDRMIESQKPYLDYLK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcaggaagtgcacaattcggatgcgatatgcttggagatattttctctactaaa
tctttggaaggttctcatattacattattagatattaatacaaatgctttaaataaagta
tatgattatgttaaagaatttatagaatcaaataaacttaattttatagttgatgctctt
acagatagaaagaaagcttttaaagatgctgactttattataagttctatagaggtaggg
gatagatttcagttatgggatgaagattggaaaatacctatgcagtacggtattcatcag
gtttatggagaaaatggaggacctggaggagtatttcactctttaagaatcattcctcct
attttggatatagtaaaagatgctatggatatatgtccgaatgcttatatatttaatttt
tctaatcctatgactgctatatgtacagctgtaaaaagagcctatcctaatgctaaattt
ataggattatgccatgaaataggctggcttcataaatggcttcctaaaattcttagaatg
aattatgagtcattggatattaaagcaggaggcctcaatcatttcagctgtctattagaa
ataaaagataaaaaaacaggaaaggatttatatcctgatgtattaaaaaatgcacatggt
tattttgagcatgaagtagggtatagtgatttattaaagtatgctaaagcaaataatgca
ttttcaaagacagaaaattttgaccattctatagaagaaagattgaaaggtgaatttata
tgggctgacagaagattattgaaagtgatattagaaaaatataaattattgcctataaca
gttgatagtcatttcggagaatatatagcttgggcttgggatgttgttgatcatagaggt
atattagatttttatgaattatatagaactgtactttctaaagctgagcctaaaatagaa
ttgatagtaaaagaaagagcttcaagcataataaatgctatagttacaaatgaaagctat
gtggaagaagcagtaaatattttaaatgacggattgatagaagatttacctaattggata
gctgttgaagtacctgctgaaataagtaaagacggagttaaaggcgtaaaattaaataat
gtacctaaaggttatttatcacttttaagaaattatgttagtgtatatgatttaactgct
gaggctgctatacatcataaaaaagaatatgcagttcaggctatacttgctaatcctgtt
gtaaatgtatgtaagaatattgaagaaatggtggatagaatgatagaaagtcaaaaacca
tatttggattatttaaaatag

DBGET integrated database retrieval system