KEGG   Brachyspira hyodysenteriae: BHWA1_01242Help
Entry
BHWA1_01242       CDS       T00865                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BHWA1_01242 (tpiA)
   01230 Biosynthesis of amino acids
    BHWA1_01242 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BHWA1_01242 (tpiA)
   00051 Fructose and mannose metabolism
    BHWA1_01242 (tpiA)
   00562 Inositol phosphate metabolism
    BHWA1_01242 (tpiA)
Enzymes [BR:bhy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BHWA1_01242 (tpiA)
Exosome [BR:bhy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BHWA1_01242 (tpiA)
  Exosomal proteins of bladder cancer cells
   BHWA1_01242 (tpiA)
  Exosomal proteins of melanoma cells
   BHWA1_01242 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1428423..1429184)
Genome map
AA seq 253 aa AA seqDB search
MARKKLIAGNWKMNNSNKEALELVNSLKGLVKDVKDRDIMIAPTFTCLSDVNNAIKGTNI
KLGAQNLYFEEKGAFTGQISADMLLAVGCEYVIIGHSECRDIFGEKDELINKKVKRALDK
NLIPVLCVGEHLEEREKGITSDIVSTQTKEAFKGLSEAEAKKVVIAYEPVWAIGTGKTAT
PQDADDVHKTIRETLKSLYNDSVAEGMIILYGGSVNEKNADDLLNMPNIDGALVGGASLV
ADKFARIVNYVAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaaaaaacttattgctggtaattggaaaatgaataattccaataaagaagct
ttagaattagttaatagtttgaagggcttagttaaagatgttaaagacagagatattatg
attgcacctacatttacttgtttaagtgatgttaataatgcaattaaaggaactaatatt
aaattaggtgctcagaatttatattttgaggaaaaaggtgctttcactggtcaaatttct
gccgacatgcttttagctgtaggatgtgagtatgttattataggacactctgaatgccgc
gatatatttggtgagaaagatgaacttataaataaaaaggtaaaaagagctttagataaa
aatcttattcctgttttatgtgtaggagaacatttagaagagagagaaaaaggtattact
tctgatatagtaagtactcaaactaaagaagcatttaaaggtttaagcgaagctgaggct
aaaaaagttgttatagcttatgaacctgtttgggctattggtacaggtaaaactgctact
cctcaggatgcagatgatgtacataaaactattagagaaactttgaaatctctttataat
gatagtgtagctgaaggtatgattatactttacggcggaagcgttaatgagaaaaatgct
gatgatttacttaatatgcctaatatagatggagcattagttggcggtgcatctttggtt
gctgataaatttgctagaatagttaattatgtagctaagtaa

DBGET integrated database retrieval system