KEGG   Brachyspira hyodysenteriae: BHWA1_01267Help
Entry
BHWA1_01267       CDS       T00865                                 

Gene name
phoB
Definition
alkaline phosphatase III
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bhy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bhy00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bhy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1452250..1453887
Genome map
AA seq 545 aa AA seqDB search
MISDFYQIIKIGEKSMIRLLPILFLAVFFIGCGQPSYNNSENDIKAKNVIILIADGQSTD
VITYSRWINGGESLAIDEMLSGAVRTHNADSPIADSAPAGTALATGYKSSYKQFIGLLPD
EAILPNSSIPTEARSPIANVLEAAQLLDKATGVVATAEIMHATPAAFSAHDITRKDYDDL
SEQQIFQNIDVILGGGYKFFTKEGRKDGKDLISEITNLGYSIIRTSDELNSFTGDKVVGL
FADADLAYDIDRNETSQPSLAQMTSKAIEILSKNKNGFFLMVEASKVDWAAHANDPVGLV
SDTLAYDAAVKAALDFAKKDNNTMVIAVTDHGNSGFSMGNYETSSDYQQVQLASLIDPIK
KASRSAEYIARKIEAGEDIRETMSKYYSINDMTAAEVNSLTGKTGDDLHYAIGPILAKRA
YLGFTSHGHTGEDVPLYTYLPNNKRITGLIDNTDIAKNIAKAMGINLDEASKKLFMSEDE
IKKAGAELTSDGQILTIRMKDKTAQMMKNRNIITVDGEKKTLAGVVVYNESKWYFPAEVL
DILNK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
ttgatatcagatttttaccaaattataaagattggagaaaaatctatgattcgattatta
cctatcctttttttagccgtattttttatcggatgcggtcagccatcttacaataattca
gaaaatgatataaaagcaaaaaatgttataattttaattgctgatggacaaagcactgat
gtaattacatattcaagatggattaatggcggagagtcattagccatagatgaaatgtta
agcggagcagtgagaactcataatgctgattctccaatagctgattctgcacctgccggt
acagctttagctactggatataaatcatcttataaacagtttataggtcttcttccagat
gaggctatacttcctaattcatcaatacctacagaagcaagaagtcctatagcaaatgta
ttagaggcagcacagcttcttgacaaagctacaggagttgttgctactgcagaaattatg
catgcaactccggcagcattttctgctcatgatatcactagaaaagactatgatgattta
agcgaacagcaaatatttcagaatatagatgttatacttggaggcggatataagtttttc
actaaagaaggcagaaaagacggaaaggatttgatatctgaaattactaatttaggttat
tctataatcagaacttctgatgaattaaattcttttacaggcgataaagttgtaggactt
tttgcagatgcagatttagcatatgatatagacagaaatgaaacatctcagccttcattg
gctcaaatgacttcaaaggctatagaaatactttctaaaaataaaaatggtttcttttta
atggtagaagcttcaaaagtggattgggctgctcatgccaatgatccggtaggattagta
tccgatactttagcttatgatgctgctgtaaaagctgcattggattttgccaaaaaagat
aataatactatggttatagctgtaacagatcatggaaacagcggtttttctatgggaaat
tatgaaacatcttcagattatcaacaagtacaattagcaagccttatagatcctataaaa
aaagcttcccgttctgctgaatatatagctagaaaaatagaagctggcgaagatataaga
gaaactatgtctaaatattattctattaatgatatgacagcggcagaagtaaattctctt
acaggaaaaacaggtgatgatttacattatgctatagggccaatattagcaaaaagagca
tatttaggattcacttctcatggacatactggagaagatgttcctctatatacttattta
cctaataataaaagaatcacaggtcttatagataatactgatatagctaaaaatattgct
aaagctatgggaataaatttagatgaagcttccaaaaaattatttatgagtgaagatgaa
ataaaaaaagcaggtgctgagctaacatctgacggtcaaattcttactatacgtatgaaa
gataaaactgctcaaatgatgaaaaacagaaatataattactgtagatggagagaaaaaa
actttagcaggagttgtggtttataatgagtctaaatggtatttccctgctgaggtatta
gatatattaaataagtaa

DBGET integrated database retrieval system