KEGG   Brachyspira hyodysenteriae: BHWA1_01267Help
Entry
BHWA1_01267       CDS       T00865                                 

Gene name
phoB
Definition
alkaline phosphatase III
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BHWA1_01267 (phoB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BHWA1_01267 (phoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BHWA1_01267 (phoB)
Enzymes [BR:bhy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BHWA1_01267 (phoB)
Exosome [BR:bhy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BHWA1_01267 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1452250..1453887
Genome map
AA seq 545 aa AA seqDB search
MISDFYQIIKIGEKSMIRLLPILFLAVFFIGCGQPSYNNSENDIKAKNVIILIADGQSTD
VITYSRWINGGESLAIDEMLSGAVRTHNADSPIADSAPAGTALATGYKSSYKQFIGLLPD
EAILPNSSIPTEARSPIANVLEAAQLLDKATGVVATAEIMHATPAAFSAHDITRKDYDDL
SEQQIFQNIDVILGGGYKFFTKEGRKDGKDLISEITNLGYSIIRTSDELNSFTGDKVVGL
FADADLAYDIDRNETSQPSLAQMTSKAIEILSKNKNGFFLMVEASKVDWAAHANDPVGLV
SDTLAYDAAVKAALDFAKKDNNTMVIAVTDHGNSGFSMGNYETSSDYQQVQLASLIDPIK
KASRSAEYIARKIEAGEDIRETMSKYYSINDMTAAEVNSLTGKTGDDLHYAIGPILAKRA
YLGFTSHGHTGEDVPLYTYLPNNKRITGLIDNTDIAKNIAKAMGINLDEASKKLFMSEDE
IKKAGAELTSDGQILTIRMKDKTAQMMKNRNIITVDGEKKTLAGVVVYNESKWYFPAEVL
DILNK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
ttgatatcagatttttaccaaattataaagattggagaaaaatctatgattcgattatta
cctatcctttttttagccgtattttttatcggatgcggtcagccatcttacaataattca
gaaaatgatataaaagcaaaaaatgttataattttaattgctgatggacaaagcactgat
gtaattacatattcaagatggattaatggcggagagtcattagccatagatgaaatgtta
agcggagcagtgagaactcataatgctgattctccaatagctgattctgcacctgccggt
acagctttagctactggatataaatcatcttataaacagtttataggtcttcttccagat
gaggctatacttcctaattcatcaatacctacagaagcaagaagtcctatagcaaatgta
ttagaggcagcacagcttcttgacaaagctacaggagttgttgctactgcagaaattatg
catgcaactccggcagcattttctgctcatgatatcactagaaaagactatgatgattta
agcgaacagcaaatatttcagaatatagatgttatacttggaggcggatataagtttttc
actaaagaaggcagaaaagacggaaaggatttgatatctgaaattactaatttaggttat
tctataatcagaacttctgatgaattaaattcttttacaggcgataaagttgtaggactt
tttgcagatgcagatttagcatatgatatagacagaaatgaaacatctcagccttcattg
gctcaaatgacttcaaaggctatagaaatactttctaaaaataaaaatggtttcttttta
atggtagaagcttcaaaagtggattgggctgctcatgccaatgatccggtaggattagta
tccgatactttagcttatgatgctgctgtaaaagctgcattggattttgccaaaaaagat
aataatactatggttatagctgtaacagatcatggaaacagcggtttttctatgggaaat
tatgaaacatcttcagattatcaacaagtacaattagcaagccttatagatcctataaaa
aaagcttcccgttctgctgaatatatagctagaaaaatagaagctggcgaagatataaga
gaaactatgtctaaatattattctattaatgatatgacagcggcagaagtaaattctctt
acaggaaaaacaggtgatgatttacattatgctatagggccaatattagcaaaaagagca
tatttaggattcacttctcatggacatactggagaagatgttcctctatatacttattta
cctaataataaaagaatcacaggtcttatagataatactgatatagctaaaaatattgct
aaagctatgggaataaatttagatgaagcttccaaaaaattatttatgagtgaagatgaa
ataaaaaaagcaggtgctgagctaacatctgacggtcaaattcttactatacgtatgaaa
gataaaactgctcaaatgatgaaaaacagaaatataattactgtagatggagagaaaaaa
actttagcaggagttgtggtttataatgagtctaaatggtatttccctgctgaggtatta
gatatattaaataagtaa

DBGET integrated database retrieval system