KEGG   Brachyspira hyodysenteriae WA1: BHWA1_01732Help
Entry
BHWA1_01732       CDS       T00865                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00520  Amino sugar and nucleotide sugar metabolism
bhy00550  Peptidoglycan biosynthesis
bhy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BHWA1_01732 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BHWA1_01732 (murA)
Enzymes [BR:bhy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BHWA1_01732 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:bhy01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BHWA1_01732 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ACN84197
UniProt: C0R259
Position
complement(2006488..2007753)
Genome map
AA seq 421 aa AA seqDB search
MIEGSNNIGGILKVSGSKNASLPLLVASILTDEPVILHNVPDLVDVHVLIDILEPLGKKV
DFKNNTTVIISHNGKSEEAPYKLVKKMRGSIIVLGPLLAKRKHCRVSYPGGCAFGPRPID
LHLKGMEALGAKIDITAGYIDAKVEGNLVGADMDLSGKFGPTVLGTDNVMMAAALAKGTT
IIRNAAKEPECTNLVDLLNAMGAKITGGSTDILTIEGVEALHGAEFTVIPDRIETGTFLA
IAAAGRGKLKLENAEPKHLTYVLDLLSDIGCDIKTTENTIEIDARNKELKPFKVETLPYP
GFPTDLQAIYTTLACTINGKSELIEGIYPDRFSHVPELIRMGADIELNTSDIVVNGGKEL
SGADVQASDLRAGAALVAAGAIAKGATNVHRIYHIERGYENLEDKLKSINIETKKEKDDI
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaaggttcaaacaatattgggggaatattaaaagtatcaggttctaaaaatgca
tcattgcctttgctagttgcatctattttaacagatgaaccagttatacttcataatgtt
ccggatttggtagatgtgcatgttcttatagatatattagagcctttagggaagaaagta
gattttaaaaataatacaactgtaataatatctcataatggaaaaagtgaggaagctcct
tataaattggttaagaaaatgagaggttctataatagtactaggaccattacttgctaag
agaaagcattgtagagtatcataccctggcggctgtgctttcggcccaagaccaatagac
ttgcatttgaaaggaatggaagcattaggtgctaaaatagatataacagcaggatatata
gatgctaaagtagaaggtaatttggtaggtgctgatatggatttatcaggtaaattcggc
cctacagtattgggtactgataatgttatgatggctgctgctttggctaaaggtactact
ataataagaaatgcagcaaaagaaccggaatgtacgaacttggttgatttgcttaatgct
atgggagcaaaaattacaggaggcagtactgatattctaactatagaaggagttgaagct
cttcatggggcagagtttacagtaataccagatagaatagaaacaggtactttcttagca
atagctgctgccggaagaggtaagttaaagttggaaaatgcagagcctaaacatttaact
tatgtattagatttgctttcagatataggatgtgatataaaaacaacagaaaatactata
gaaatagatgctagaaataaagaattaaaaccttttaaagttgaaacattaccatatcct
ggttttcctacagatttgcaggctatttatactacattagcttgtacaatcaatggaaag
agcgagcttatagagggtatttatcctgatagattcagccatgtaccggaacttattcgt
atgggtgctgacatagaattaaatacttcagatatagttgtaaatggaggcaaggaatta
tcaggggctgatgtacaggctagtgatttaagagctggtgctgctttggttgctgctggt
gctattgctaaaggtgcaactaatgttcatagaatctatcatatagaaagaggatatgaa
aatttagaagataaattaaaaagtattaatatagaaacaaaaaaagaaaaagatgatatt
ttataa

DBGET integrated database retrieval system