KEGG   Brachyspira hyodysenteriae WA1: BHWA1_01937Help
Entry
BHWA1_01937       CDS       T00865                                 

Gene name
porG
Definition
(GenBank) pyruvate oxireductase
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00010  Glycolysis / Gluconeogenesis
bhy00020  Citrate cycle (TCA cycle)
bhy00620  Pyruvate metabolism
bhy00640  Propanoate metabolism
bhy00650  Butanoate metabolism
bhy00680  Methane metabolism
bhy01100  Metabolic pathways
bhy01120  Microbial metabolism in diverse environments
bhy01130  Biosynthesis of antibiotics
bhy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BHWA1_01937 (porG)
   00020 Citrate cycle (TCA cycle)
    BHWA1_01937 (porG)
   00620 Pyruvate metabolism
    BHWA1_01937 (porG)
   00640 Propanoate metabolism
    BHWA1_01937 (porG)
   00650 Butanoate metabolism
    BHWA1_01937 (porG)
  Energy metabolism
   00680 Methane metabolism
    BHWA1_01937 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BHWA1_01937 (porG)
Enzymes [BR:bhy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BHWA1_01937 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_6 Fer4_7 Fer4 Fer4_2 Fer4_9 Fer4_21 Fer4_10 Fer4_17 Fer4_8 Fer4_4 BRCT Fer4_3
Motif
Other DBs
NCBI-ProteinID: ACN84398
UniProt: C0QV97
Position
2230053..2231090
Genome map
AA seq 345 aa AA seqDB search
MKLPKVNDLGFFEIRLESIGGMGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKS
FVRFSDTEVRVNSTVEEPHVVAVFHMNLLKNPMTLAGVKEDAIVIFNTNKTPDEARDFAK
LHGGKVVCVDAIKIANDLKLPSQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFSGKKPEL
VEPNVEAFRRGGSDSVVKDFPADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDL
QVTRTGNIPVFNPKNCIDCANCEVVCPDLCIVWERGTDRKDASKTNVMNMMGIDYQYCKG
CLKCVRACPKGPYAPKQLPKEEQALRIEVEAECNVDELTYRRYKK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcccaaaagtcaatgatttaggctttttcgagattcgtctcgaaagtataggc
ggaatgggtgctaatagtgctggtaaaatgcttgcagaagtaggtgttttgactcaaggt
ttctatggtgctgcattctcaagttatggttcagaaaagaaaggttcaccagttaaatct
ttcgtaagattttctgatacagaagttagagttaactctacagtagaagagcctcatgtt
gtggctgtattccatatgaatcttcttaaaaaccctatgacattagctggtgttaaagaa
gatgctatcgttatttttaacactaataaaacacctgatgaagcaagagactttgctaaa
ttacatggtggtaaagtagtttgtgttgatgctattaaaatcgctaatgatttaaaactt
ccttcacaagcagctaacactatcattatgggtgctatggttaatcagcttgactttata
gattctgctaaatttgaagagcaaattagaaagcaattctctggtaaaaaaccagaatta
gtagaacctaacgttgaagctttcagaagaggcggaagcgactctgtagtaaaagatttc
cctgcagatggtaaatatccatatataccttacaaaaaaccagaacctgtatatggtaaa
aacaaccaattaacaggcggttatatcaatgctgctggtaactctactttgaaagatttg
caagttactcgtacaggtaatataccagtattcaatcctaaaaactgtatagactgtgct
aactgtgaagttgtttgtccagacctttgtatcgtttgggaaagaggtactgatagaaaa
gatgcttctaaaacaaatgttatgaatatgatgggtattgattatcaatattgtaaaggc
tgcttaaaatgcgttagagcttgccctaaaggaccttatgctcctaaacagcttcctaaa
gaagaacaagctttaagaatagaagtagaagcagaatgtaatgttgatgaacttacatac
agacgttataaaaaataa

DBGET integrated database retrieval system