KEGG   Brachyspira hyodysenteriae: BHWA1_01937Help
Entry
BHWA1_01937       CDS       T00865                                 

Gene name
porG
Definition
pyruvate oxireductase
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bhy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bhy00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bhy00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bhy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bhy00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bhy00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:bhy00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:bhy00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2230053..2231090
Genome map
AA seq 345 aa AA seqDB search
MKLPKVNDLGFFEIRLESIGGMGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKS
FVRFSDTEVRVNSTVEEPHVVAVFHMNLLKNPMTLAGVKEDAIVIFNTNKTPDEARDFAK
LHGGKVVCVDAIKIANDLKLPSQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFSGKKPEL
VEPNVEAFRRGGSDSVVKDFPADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDL
QVTRTGNIPVFNPKNCIDCANCEVVCPDLCIVWERGTDRKDASKTNVMNMMGIDYQYCKG
CLKCVRACPKGPYAPKQLPKEEQALRIEVEAECNVDELTYRRYKK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcccaaaagtcaatgatttaggctttttcgagattcgtctcgaaagtataggc
ggaatgggtgctaatagtgctggtaaaatgcttgcagaagtaggtgttttgactcaaggt
ttctatggtgctgcattctcaagttatggttcagaaaagaaaggttcaccagttaaatct
ttcgtaagattttctgatacagaagttagagttaactctacagtagaagagcctcatgtt
gtggctgtattccatatgaatcttcttaaaaaccctatgacattagctggtgttaaagaa
gatgctatcgttatttttaacactaataaaacacctgatgaagcaagagactttgctaaa
ttacatggtggtaaagtagtttgtgttgatgctattaaaatcgctaatgatttaaaactt
ccttcacaagcagctaacactatcattatgggtgctatggttaatcagcttgactttata
gattctgctaaatttgaagagcaaattagaaagcaattctctggtaaaaaaccagaatta
gtagaacctaacgttgaagctttcagaagaggcggaagcgactctgtagtaaaagatttc
cctgcagatggtaaatatccatatataccttacaaaaaaccagaacctgtatatggtaaa
aacaaccaattaacaggcggttatatcaatgctgctggtaactctactttgaaagatttg
caagttactcgtacaggtaatataccagtattcaatcctaaaaactgtatagactgtgct
aactgtgaagttgtttgtccagacctttgtatcgtttgggaaagaggtactgatagaaaa
gatgcttctaaaacaaatgttatgaatatgatgggtattgattatcaatattgtaaaggc
tgcttaaaatgcgttagagcttgccctaaaggaccttatgctcctaaacagcttcctaaa
gaagaacaagctttaagaatagaagtagaagcagaatgtaatgttgatgaacttacatac
agacgttataaaaaataa

DBGET integrated database retrieval system