KEGG   Brachyspira hyodysenteriae: BHWA1_01937Help
Entry
BHWA1_01937       CDS       T00865                                 

Gene name
porG
Definition
pyruvate oxireductase
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BHWA1_01937 (porG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BHWA1_01937 (porG)
   00020 Citrate cycle (TCA cycle)
    BHWA1_01937 (porG)
   00620 Pyruvate metabolism
    BHWA1_01937 (porG)
   00640 Propanoate metabolism
    BHWA1_01937 (porG)
   00650 Butanoate metabolism
    BHWA1_01937 (porG)
  Energy metabolism
   00680 Methane metabolism
    BHWA1_01937 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BHWA1_01937 (porG)
Enzymes [BR:bhy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BHWA1_01937 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2230053..2231090
Genome map
AA seq 345 aa AA seqDB search
MKLPKVNDLGFFEIRLESIGGMGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKS
FVRFSDTEVRVNSTVEEPHVVAVFHMNLLKNPMTLAGVKEDAIVIFNTNKTPDEARDFAK
LHGGKVVCVDAIKIANDLKLPSQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFSGKKPEL
VEPNVEAFRRGGSDSVVKDFPADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDL
QVTRTGNIPVFNPKNCIDCANCEVVCPDLCIVWERGTDRKDASKTNVMNMMGIDYQYCKG
CLKCVRACPKGPYAPKQLPKEEQALRIEVEAECNVDELTYRRYKK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcccaaaagtcaatgatttaggctttttcgagattcgtctcgaaagtataggc
ggaatgggtgctaatagtgctggtaaaatgcttgcagaagtaggtgttttgactcaaggt
ttctatggtgctgcattctcaagttatggttcagaaaagaaaggttcaccagttaaatct
ttcgtaagattttctgatacagaagttagagttaactctacagtagaagagcctcatgtt
gtggctgtattccatatgaatcttcttaaaaaccctatgacattagctggtgttaaagaa
gatgctatcgttatttttaacactaataaaacacctgatgaagcaagagactttgctaaa
ttacatggtggtaaagtagtttgtgttgatgctattaaaatcgctaatgatttaaaactt
ccttcacaagcagctaacactatcattatgggtgctatggttaatcagcttgactttata
gattctgctaaatttgaagagcaaattagaaagcaattctctggtaaaaaaccagaatta
gtagaacctaacgttgaagctttcagaagaggcggaagcgactctgtagtaaaagatttc
cctgcagatggtaaatatccatatataccttacaaaaaaccagaacctgtatatggtaaa
aacaaccaattaacaggcggttatatcaatgctgctggtaactctactttgaaagatttg
caagttactcgtacaggtaatataccagtattcaatcctaaaaactgtatagactgtgct
aactgtgaagttgtttgtccagacctttgtatcgtttgggaaagaggtactgatagaaaa
gatgcttctaaaacaaatgttatgaatatgatgggtattgattatcaatattgtaaaggc
tgcttaaaatgcgttagagcttgccctaaaggaccttatgctcctaaacagcttcctaaa
gaagaacaagctttaagaatagaagtagaagcagaatgtaatgttgatgaacttacatac
agacgttataaaaaataa

DBGET integrated database retrieval system