KEGG   Brachyspira hyodysenteriae: BHWA1_01938Help
Entry
BHWA1_01938       CDS       T00865                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxireductase
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BHWA1_01938 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BHWA1_01938 (porA)
   00020 Citrate cycle (TCA cycle)
    BHWA1_01938 (porA)
   00620 Pyruvate metabolism
    BHWA1_01938 (porA)
   00640 Propanoate metabolism
    BHWA1_01938 (porA)
   00650 Butanoate metabolism
    BHWA1_01938 (porA)
  Energy metabolism
   00680 Methane metabolism
    BHWA1_01938 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BHWA1_01938 (porA)
Enzymes [BR:bhy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BHWA1_01938 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2231105..2233369
Genome map
AA seq 754 aa AA seqDB search
MANKYNLAEQENILESGNELAAIAAAQINYHVMGYYPITPSTQIAEYLDEMKANGRHTVC
MIPGDGEHGAAGICYGATTAGGRVFNATSANGLLFAMEQLPVQAGTRFPMVLNVVNRTVS
GPLDIKCDQSDIMMALNTGWIIIMAHTTQMVYDFNIFALKIAERAKLPIIVSSDGFFTSH
QKKKIHLFKNDKDVQDFLGTYTPEVTSVEPGKNPVTIGPYMNEDELTGSKLQLSQALEDS
RAIILDVFEEFASLSGRKYSPIETYNMEGAEVALMLCGSAYETGTLAVDEMKKANPNLKI
GAFAITQIRPFPEKELQKLLANVKVVVVGDRQDSYSGMGGNMSTEIRAALKNDVNNKSSI
VSRVYGLGGTEFTLEKAKELFELGLKELANPGSVEKHSYLEQYMGHAGVEMKPIHEPLTL
ESQKSGITVTMNEQTHKLEVKVPPLRELTGKAYRYAQGHGACNGCGIFSGINTFMKGIEG
EVVLLVHTGCSMVVTTGYPYSSYRTTYVHNLFQNGAATLSGVVEMYHERKRRGEIQGPED
PTFIMVTGDGGHDIGMGPSIGAAIRNHKMIILEYDNEGYMNTGNQLSFSTPIGHRTSTSN
VGKAEVGKQFNHKDVAQIFAGCHIPYVATGCESYPLDLIKKAAKAQWYANHHGTAFVKLL
IACPLNWKSPDDMGKDVIKAAVDCCFFPLYEVEHGITTITTMVADDKKIPVTEWLKMMGK
TKHLLKHQDLLDSFQKEVDRRWTRIKAMHESPVL
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaaatataatcttgctgaacaagaaaacatacttgaaagtggtaatgaatta
gcagccattgcagccgctcaaatcaattatcacgttatgggttattacccaatcactcca
tctactcaaattgctgagtacttggatgaaatgaaagctaatggaagacacactgtttgc
atgatccctggtgacggtgaacatggtgctgctggtatctgttatggtgctactactgct
ggcggtagagtattcaatgctacttctgctaacggtcttctttttgctatggaacaatta
cctgttcaagcaggtactagattccctatggtattaaacgttgtaaacagaactgtttct
ggtccattagatattaaatgtgaccaatctgatattatgatggctcttaacactggttgg
atcatcattatggctcacactactcagatggtttatgacttcaatatctttgctttaaaa
atcgctgaaagagctaaacttcctatcatagtttcttctgacggattctttacttctcac
cagaagaaaaaaatacacttattcaaaaatgataaggatgtacaagacttcttaggtact
tatactcctgaagttacttcagttgaaccaggaaaaaatcctgttacaattggaccttac
atgaacgaagatgagttaactggaagtaaattacagctttctcaagctttagaagattct
agagctattatcttagatgtatttgaagagtttgcttctctttctggaagaaaatactct
cctatagaaacttacaacatggaaggtgctgaagttgctttaatgctttgcggttctgct
tatgaaactggcactttagctgttgacgaaatgaaaaaagctaatcctaaccttaaaata
ggtgcatttgctatcactcaaattcgtcctttccctgaaaaagaattacaaaaattatta
gctaatgttaaagttgtagtagtaggtgacagacaagattcatactctggtatgggcggt
aatatgtctactgaaatcagagctgctttgaaaaacgatgtaaacaataaatcttctatt
gtgagcagagtttatggtcttggcggtactgaatttactcttgaaaaagctaaagaatta
tttgaattaggtttaaaagaattagctaaccctggttctgttgaaaaacattcttactta
gaacaatatatgggtcatgctggtgttgaaatgaaacctatacatgaacctcttacttta
gagagccaaaaatctggtattactgttactatgaacgaacaaactcataaacttgaagtt
aaagttccacctcttagagaattaactggtaaagcttatcgttatgctcaaggtcatggt
gcttgtaacggttgcggtatcttctctggtatcaatactttcatgaaaggtatcgaaggt
gaggttgttcttttagtacatactggttgttctatggttgttactactggttatccttac
agctcttatagaactacttatgttcacaacttattccaaaacggtgctgctactctttct
ggtgttgttgaaatgtatcatgaaagaaaaagaagaggagaaattcaaggacctgaagat
cctactttcataatggttactggtgacggtggtcatgacataggtatgggaccttctatc
ggtgctgctattagaaatcacaaaatgattatattagaatatgataatgaaggatacatg
aacactggtaaccaattatcattctctactcctataggacatagaacttctacttctaac
gttggtaaagctgaagttggtaaacagtttaaccacaaagatgttgctcaaatcttcgct
ggttgtcatataccttatgttgctactggatgtgaatcttatcctttagatttgatcaag
aaagctgctaaagctcagtggtatgctaatcatcatggtactgcttttgttaaacttctt
atcgcttgtccattgaactggaaatctcctgatgatatgggtaaagatgttattaaagct
gctgttgattgctgcttcttcccattatatgaagttgaacatggtatcactactattact
actatggtagctgatgataagaaaatacctgttactgaatggttgaaaatgatgggtaaa
actaaacaccttcttaaacatcaagacttacttgactctttccaaaaagaagttgacaga
agatggactagaatcaaagctatgcatgaaagtcctgttctataa

DBGET integrated database retrieval system