KEGG   Brachyspira hyodysenteriae: BHWA1_01960Help
Entry
BHWA1_01960       CDS       T00865                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bhy00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2258384..2259868)
Genome map
AA seq 494 aa AA seqDB search
MAKYVVAIDQGTTSSRAIVFDYDQNMVSVAQKEFTQIYPHEGWVEHNAAEIWATQFGVLQ
EAIQIAGVKPEEIAAIGITNQRETTVVWDKNTGEPIYNAIVWQCRRTAPICDELKKKGLD
TYIRENTGLVVDAYFSGTKIKWILDNVPGAREKANKGELLFGTIDTWLVWKLTGGKVHVT
DYTNASRTMIYNIKELKWDETILKELDIPMSMLPEVKDSSCIYGYAHINGKEVPISGIAG
DQQSALFGQAGFNKGDTKNTYGTGSFILMNIGENFILSKNGLITTIAIGYNGKIEYALEG
SVFIAGAVIQWVRDELRLLHDAKDTEYFATKVKDTNGVYLVPAFVGLGAPYWDMYARGCL
VGITRGVNRSHIIRAAEEAIAYQSKDVIDAMVADSGVKLSSLKVDGGACRDNFLMQFQSD
IINTKVLRPQITETTALGAAYLAGLAVGFWKDKDEITNRWKLEREFTPSLSEEERNKKYM
GWKKAVERSRGWAL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatatgtagtggcaatagatcagggtacaacaagcagcagagctatagtattt
gattatgatcaaaatatggtatcagttgctcaaaaagagtttactcaaatttatccccat
gaaggctgggtagaacataatgcagctgagatttgggctactcaatttggggttttgcag
gaagctatacagattgccggagttaaaccggaagaaatagctgctattggtattactaac
caaagagaaactactgtagtatgggataaaaatacaggagagcctatttataatgctata
gtttggcaatgccgaagaacagctcctatttgcgatgaattaaagaaaaaaggtcttgat
acatatataagagaaaatacaggtttggtagtggatgcttatttctccggcaccaaaata
aaatggatactcgataatgtaccaggtgcaagagaaaaagctaataaaggcgaactatta
ttcggtacaatagatacttggcttgtatggaagcttacaggcggtaaagtgcatgttaca
gattatactaatgcatcaaggactatgatatataatattaaagaacttaaatgggatgaa
accattttaaaagaattggacatacctatgagtatgcttcctgaagtaaaagattcttct
tgtatttacggatatgctcatattaatggaaaagaagttcctatatcaggcatagcagga
gaccagcaatccgctttattcggacaagctggattcaacaagggagatactaaaaatact
tatggtacaggaagcttcatacttatgaatataggtgaaaacttcatattaagtaagaac
ggactaatcaccactatagctatcggatataatggaaaaatagaatatgctttggaaggc
tctgtatttatagcaggtgccgttatacaatgggtaagagatgaactaagacttcttcat
gatgctaaagatactgaatatttcgctacaaaggtaaaagacactaatggagtttattta
gtaccggcattcgttggtcttggtgctccttattgggatatgtatgctagaggctgttta
gtaggtattactagaggagttaatagaagccatataataagggctgctgaagaggctatt
gcttatcaaagtaaagatgttatagatgctatggttgcagacagcggagttaagctttct
tcattaaaagttgacggcggagcatgccgagataatttcttaatgcagtttcaatctgat
attattaatacaaaagttcttcgtcctcaaatcactgaaactacagctttaggtgctgct
tatttagctggacttgctgttggattctggaaagataaagatgaaatcactaacagatgg
aaattagagagagagtttactccttcactttctgaagaagaaagaaataaaaaatatatg
ggttggaaaaaagccgttgaaagatcaagaggctgggctttataa

DBGET integrated database retrieval system