KEGG   Brachyspira hyodysenteriae: BHWA1_02311Help
Entry
BHWA1_02311       CDS       T00865                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BHWA1_02311 (rbsK)
Enzymes [BR:bhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BHWA1_02311 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2618406..2619293
Genome map
AA seq 295 aa AA seqDB search
MSKKVLVIGSINKDLVVTAPRFPKEGETILGNSFYTGNGGKGANQACAIGKLGGDVSILG
AVGDDSFAKDLCNALISNNVNTDNLIVKNNVSTGIAVITVTEYGANNIIVAQGANALITK
DDIKEELISLYDIIVIQLEIPLEIAEYAAYIAKKLGKTVVLNPSPAVKLSRDFLSYADIL
IPNETEIDIIGGIDYAFECGVKNIILTLGANGCDFINKEGRKHFDAYKVNVVDTTAAGDS
FLGGVVRMIADNKSIEEAIIFATKVSNITVTRKGAIDSIPTYDEVVSKKWCQIPM
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaagttttagttataggaagcataaataaagatttagttgtaactgctcct
cgttttcctaaagaaggagaaacaatattaggaaatagtttttatacaggaaatggagga
aaaggagcaaatcaggcttgtgccataggtaaattaggcggtgatgtaagtatacttggt
gctgtaggagatgatagttttgcaaaagatttatgcaatgctttaatatctaataatgtt
aatactgataatttaatagtaaaaaataatgtttctacaggcattgcggttattactgtt
actgagtatggtgcaaataatattattgtggcacaaggagctaatgctttaattacaaaa
gatgatataaaagaagaattaatatctttatatgatataatagttatacagcttgaaatt
ccattagaaatagctgaatatgctgcatatattgctaaaaaactaggaaaaacagttgtc
ctcaatccttctccggctgtaaagctaagcagagattttttaagttatgctgatatactt
attcctaatgaaacagagatagatattataggcggtatagattatgcatttgaatgcgga
gttaaaaatataatacttactttgggtgctaatggatgcgattttataaataaagaagga
agaaaacattttgatgcttataaagtaaatgttgttgatactactgctgcaggtgatagt
tttttgggtggagttgtaagaatgatagctgataataaatctatagaagaagctataatt
ttcgctacaaaagtttctaatataacagttactagaaaaggagcaatagattccatacca
acttatgatgaagttgtatctaaaaaatggtgccaaattcctatgtaa

DBGET integrated database retrieval system