KEGG   Brachyspira hyodysenteriae: BHWA1_02412Help
Entry
BHWA1_02412       CDS       T00865                                 

Gene name
lacZ
Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bhy  Brachyspira hyodysenteriae
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BHWA1_02412 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    BHWA1_02412 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BHWA1_02412 (lacZ)
Enzymes [BR:bhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BHWA1_02412 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2719919..2722144)
Genome map
AA seq 741 aa AA seqDB search
MREIINFNTNWKFTKEWNDNIKIEKLNGENITLPHTVAEIPLHYFSESDTWLVSGYQNTF
KYDKSKLQGKRVLINFEAAMAACEVFVNEKSFGEHKGGYLPFVYDITDELKDGENIIAVK
LDSTEREDIPPFGNEIDYLCYGGIYREVQIIIVDDVSIENVMLTGLANQNITGKIRIRNT
KKESVKETISINLYNREYHICEIKKEITLKKGELFTDIKIDEHIDSDRIELWDIDNPRLY
RLEVSLPNEDSVSIKIGFRDAKFTENGFFLNDKRVKLRGLNRHQSFPYVGYAMPERIQKK
DADILKFDLGLNIVRSSHYPASRHFLDRCDEIGLMVFEEIPGWQHIGDKKWQSVSIENVK
DMIERDFHHASIIIWGVRINESQDNHSFYKETNKKAHELDKTRQTGGVRYLVGSELLEDV
YTMNDFNYDGVADPLRAQKFVTKLDKNVPYMITEYNGHMFPTKMQDCEERLMEHTKRHFE
IINAVAIDKHISGSTGWCAFDYHTHYNFGSGDRICYHGVYDMFRNPKLAASAYSSQMSTR
NEIILEPITIYARGERAIGGISPLMVATNCDYVELYYRDELMAKEYPATGKYQGLKHAPV
IIKMEVNIPGVSDMGWGDMKLIGYIDGKPAIEKNYLNNPTFKGLEVKADDDEINAVSGGS
AWDSTRITVKAVDAIGNRLPYINEAITIEVKGAGELIGNDNPVLEGGYYSFWVKSNKSKG
SIKVTVKNKRVKEATIEIKSI
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaataatcaattttaatacaaattggaaatttacaaaagaatggaatgataat
ataaaaattgaaaaactaaatggggaaaatatcacattgcctcatacagttgctgaaata
cctcttcattattttagtgaatcagacacttggctagtttcaggatatcaaaacactttt
aaatatgataaatcaaaattacaaggtaaaagagtattaatcaattttgaagctgctatg
gccgcttgtgaggtatttgttaatgaaaaaagttttggagagcataaaggcggatattta
ccttttgtatatgatataacagatgaattaaaagacggagaaaatattatagctgtaaaa
ctagatagcactgaaagagaagatataccgcctttcggaaatgaaatagattatttatgc
tatggcggaatatacagagaagttcaaattataatagttgatgatgtatcaatagaaaat
gttatgcttacaggacttgctaatcaaaatataacaggaaaaataagaataagaaatact
aaaaaagaaagtgttaaagaaacaatttctattaacttgtacaatagagaatatcatata
tgcgaaataaaaaaagaaataacattaaaaaaaggcgaattatttactgatataaaaata
gatgaacatatagattctgatagaatagaattatgggatatagataatccaagactttat
agactagaggtatctttgcctaatgaagatagtgtttctataaaaataggatttagagat
gctaaattcacagaaaacggatttttcttaaatgacaaaagagtaaaattaagaggatta
aacagacatcaaagcttcccttatgtaggctatgctatgcctgaaagaatacaaaagaaa
gatgctgatatattaaaatttgatttagggcttaatatagttcgttcttcacactaccct
gcttcaagacattttttagacagatgcgatgaaataggattaatggtatttgaagaaatt
ccaggatggcagcatataggtgataaaaaatggcagagtgtttctatagaaaatgtaaaa
gatatgatagaaagagattttcatcatgcttccattataatatggggtgtaagaatcaat
gaaagtcaggataatcatagcttctataaagaaactaataaaaaagcccatgaacttgat
aaaacaagacaaacaggcggagtaagatatttagtgggaagtgagcttttagaagatgta
tatactatgaatgattttaattatgatggtgttgctgatcctttaagagcacagaaattc
gtaactaaattagataaaaatgttccatatatgataacagaatacaatggacatatgttc
cctacaaaaatgcaggactgtgaagaaagattaatggaacatacaaaaagacattttgaa
ataattaatgctgttgctatagataaacatatttccggttctacaggctggtgtgctttc
gattatcatactcattataattttggttcaggtgacagaatatgctatcatggtgtctat
gatatgtttagaaatcctaaattagcagcttctgcatattcatctcaaatgagcacaaga
aatgaaataatattagagcctataactatatatgccagaggagaaagagctataggagga
atatctcctttgatggttgctacaaattgtgattatgtagaactttattatagagatgaa
ttaatggcaaaagaatacccagcaacaggtaaatatcagggattaaagcatgctcctgtt
ataataaaaatggaagtaaatattccaggagtaagcgatatgggctggggtgatatgaaa
ttaataggatatatagatggtaagcctgctatagaaaaaaattatttgaacaaccctact
ttcaaaggtttggaagttaaagcagatgatgatgaaatcaatgctgtaagcggcggttct
gcttgggattcaacaagaataacagtaaaagcggtagatgctataggaaacagactgcca
tatattaatgaggctataactatagaggtaaagggagctggagaattgataggaaatgat
aatcctgtacttgaaggcggttattattctttctgggttaaatcaaataaatccaaagga
agtataaaagttacagtaaaaaataaaagagtaaaagaagcaacaatagaaataaaatca
atataa

DBGET integrated database retrieval system