KEGG   Brachyspira hyodysenteriae WA1: BHWA1_02459Help
Entry
BHWA1_02459       CDS       T00865                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00010  Glycolysis / Gluconeogenesis
bhy00030  Pentose phosphate pathway
bhy00051  Fructose and mannose metabolism
bhy00052  Galactose metabolism
bhy00680  Methane metabolism
bhy01100  Metabolic pathways
bhy01110  Biosynthesis of secondary metabolites
bhy01120  Microbial metabolism in diverse environments
bhy01130  Biosynthesis of antibiotics
bhy01200  Carbon metabolism
bhy01230  Biosynthesis of amino acids
bhy03018  RNA degradation
Module
bhy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BHWA1_02459 (pfkA)
   00030 Pentose phosphate pathway
    BHWA1_02459 (pfkA)
   00051 Fructose and mannose metabolism
    BHWA1_02459 (pfkA)
   00052 Galactose metabolism
    BHWA1_02459 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BHWA1_02459 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BHWA1_02459 (pfkA)
Enzymes [BR:bhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BHWA1_02459 (pfkA)
Protein phosphatases and associated proteins [BR:bhy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BHWA1_02459 (pfkA)
Messenger RNA biogenesis [BR:bhy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BHWA1_02459 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACN84913
UniProt: C0QXP7
Position
complement(2769982..2770962)
Genome map
AA seq 326 aa AA seqDB search
MADIKRIGVLTSGGDASGMNPAIRSVVRTAIANGLEVMGIKEGYQGLMYNDVYQMNAGSV
GGIINHGGTILFSARSPEFQTEEGMKKAADNMKYHGIDALIVIGGDGTYKGALDFYNHHP
EYPIVAIPGTIDNDIFGTDYTIGYDTAVNVAMDAIDKLRDTATSHGRCFVVEVMGRHAGY
IALEVGIASGAEDILIPETTTDMDKIVEELQIAKKRGKKSSIIVVAEGDESGGAMEVAKQ
IEGKTGFDTRVTILGHMQRGGSPTSRERLMAARFGYIAVKALLEGKKNVAVGIWKGEYTY
TPLTDAVKKVPKVDPIDLALCRTLAI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgatataaaaagaattggggtattaacaagcggaggagatgcttctggaatgaac
cctgctataagaagcgttgttagaactgcaatagccaatggtttagaagtaatgggcata
aaagaaggataccaaggtcttatgtataatgatgtatatcagatgaatgcaggaagcgta
ggaggcatcattaatcatggcggtactatactattctcagcaagatctcctgaattccaa
acagaagaaggtatgaaaaaagctgcagacaatatgaaatatcatggtattgatgcttta
attgttataggcggagacggaacttataaaggagcattagatttctataatcatcaccct
gaatatcctatagtagcaataccaggaacaatagataatgatatatttggtacagattat
actataggttatgatactgctgttaatgtggcaatggatgctatagataaattaagagat
acagctacaagccatggaagatgttttgttgtagaagttatgggaagacatgctggttat
attgctttagaagtaggtatagcttcaggtgctgaggatatattaatacctgaaactact
actgatatggataaaatagtagaagaattacaaattgctaaaaaaagaggtaaaaaatct
tctataatagtagtagccgaaggagatgaatccggtggagctatggaagttgctaaacaa
atagaaggtaaaacaggttttgatactcgtgttactatattaggacacatgcaaagagga
ggttctcctacttcaagagaacgtttgatggctgcaagatttggttatatcgctgttaaa
gctttattggaaggaaagaaaaatgttgctgtaggaatatggaaaggcgaatatacttat
actcctttaactgatgctgtaaaaaaagtgcctaaagtagatcctatagacttggcatta
tgcagaacacttgctatataa

DBGET integrated database retrieval system