KEGG   Beijerinckia indica: Bind_0005Help
Entry
Bind_0005         CDS       T00688                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bid  Beijerinckia indica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bid00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bind_0005
Enzymes [BR:bid01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bind_0005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3668..4285
Genome map
AA seq 205 aa AA seqDB search
MIGKLTGLVDSQGEDHVILDVQGVGYIVFCSSRTLRLLPKPGASTALLIEMQVREDAIRL
FGFPSEVERDWFRLLQSVQGVGAKVALALQGLLSATELAQAIALQDKASLGRAPGVGPKL
AARLITELKDKMPALGPVDSLTAKLTIAEAEGTAPVAAQDAITALVNLGYGRPQAAAAVA
TSLEALGETAPLADLIRRGLKELAR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctgaccggcctcgtggatagccaaggggaggatcatgtgatcctcgac
gtgcagggcgtcggctacatcgtcttttgttcgagccggactttgcggctcctgccgaag
cccggcgcgtcgaccgcgctcctcatcgagatgcaggtgcgcgaggatgcgatcagactt
tttggctttccctcggaagtcgagcgcgactggttccgcctgttgcaatcggtgcaaggc
gtcggtgcgaaggttgcgctcgctttgcagggcctgctcagtgccaccgagcttgcgcag
gcgattgcccttcaggacaaagcctctcttggccgtgcacctggagtcggcccgaaactc
gccgcccgcctcatcacggaattgaaggataaaatgccggcgctcgggccggtcgattcc
ctgacagcaaagctcactattgccgaagcagagggtacggcgcctgtcgccgcgcaagac
gcgatcaccgctctcgttaatctcggctatggccggcctcaagcggcggcggctgtcgcg
acatcgctcgaagctttgggagaaacggcgccgctcgccgatttgattcgccgcggcctg
aaggaattggcgcggtag

DBGET integrated database retrieval system