KEGG   Beijerinckia indica: Bind_0011Help
Entry
Bind_0011         CDS       T00688                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
bid  Beijerinckia indica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bind_0011
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bind_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(8947..9345)
Genome map
AA seq 132 aa AA seqDB search
MIKTVSFSLAAFLSLAGATAVLAAGDPEAGEKIFTTKCKVCHQIGPGAKNFVGPELNGLI
GRKAGTSEGYTYSDAMKNSGLTWDEATFKDYIKNPKAKLPGIKMIFAGLPKESDQDNLTA
YLATFDATGAKK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaactgtttctttctccctggctgcctttttgagcctggccggcgccaccgcc
gtgctggccgccggcgatcccgaagccggtgagaagatcttcaccaccaaatgcaaggtc
tgccatcagatcggaccgggcgccaagaatttcgtcggtccggaactgaacgggctgatc
ggccgcaaggcgggtacgtccgagggttatacttattcggatgcgatgaagaattccggt
ctgacctgggatgaagcgaccttcaaggactatatcaagaaccccaaggccaagctccct
ggcatcaagatgatcttcgctggcctgccgaaggaaagcgatcaggacaatctcaccgct
tatctcgcgaccttcgacgccaccggcgccaaaaagtaa

DBGET integrated database retrieval system