KEGG   Beijerinckia indica: Bind_0047Help
Entry
Bind_0047         CDS       T00688                                 

Definition
(GenBank) isocitrate lyase and phosphorylmutase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bid  Beijerinckia indica
Pathway
bid00630  Glyoxylate and dicarboxylate metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01200  Carbon metabolism
Module
bid_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bind_0047
Enzymes [BR:bid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bind_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2 Nuc_rec_co-act DUF1843 DUF1771
Motif
Other DBs
NCBI-ProteinID: ACB93706
JGI: Bind0047
UniProt: B2IB06
Position
complement(46724..48316)
Genome map
AA seq 530 aa AA seqDB search
MSYQDQITEVSQLIKSKNGTWDGINAEAVVRMRLQNRFKTGLDIAKYTAAIMRRDMAAYD
ADTTKYTQSLGCWHGFIGQQKVISIKKHFGTTERRYLYLSGWMVAALRSEFGPLPDQSMH
EKTSVPALIEELYTFLRQADARELNDIFRAIDAARKAGDSAKAKELLTQAENHQTHVIPI
IADIDAGFGNAEATYLLAKKMIEAGAGALQIENQVSDEKQCGHQDGKVTVPHEDFLAKVR
ACRYAFLELGVDDGIVVTRTDSLGAGLTKQIAVSHKPGDLGDQYNSFLDVEEVPAGGGAN
GDVIINRDGKLFRPKRLPSNLFQFRKGTGEDRCVLDSITSLQNGADLLWIETEKPHVEQI
AGMMDRIRAVIPNAKLVYNNSPSFNWTINFRQQVYDAWKEAGKDVSAYDRAGLMDVKYDG
SDLAAEADEKIRTFQADASKRAGIFHHLITLPTYHTAALSTDNLAKEYFGEQGMLGYVLN
VQRQEIRQKIACAKHQNMAGSDIGDDHKEYFAGEAALKAGGADNTMNQFG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatcaagaccaaattaccgaggtgagccagctcatcaagagcaagaacggcaca
tgggacggcatcaatgccgaggccgtcgtccggatgcgcttgcagaaccgcttcaaaacc
ggtctcgatattgccaaatatacggcagccatcatgcgccgggacatggcggcctatgac
gcagacaccaccaaatatactcagtcgctcggctgctggcacggtttcatcggccagcag
aaggtgatttcgatcaaaaagcatttcggcacgaccgaacgccgctacctttacctctcc
ggctggatggtcgccgcgctgcgttccgagttcggcccgctgcccgaccagtcgatgcat
gaaaagacctccgtcccggcgcttatcgaggagctttacaccttcctccgccaggccgat
gcacgtgagctcaacgatattttccgcgccatcgacgccgcccgcaaggcgggagacagc
gccaaggcgaaagagcttctgacccaggccgaaaatcaccagacccatgtcattccgatc
atcgccgatattgacgcgggcttcggcaacgccgaagcgacctatcttctcgccaagaag
atgatcgaggcgggcgccggcgccctgcaaatcgaaaaccaggtctcggatgaaaagcaa
tgcggccaccaagacggcaaggtcaccgtgccgcacgaggatttcttggccaaggtgcgc
gcctgccgctatgccttcctcgaactcggcgttgatgatggcatcgttgtcacccgcacc
gactctcttggcgccggtctcaccaagcagatcgcggtcagccacaagccgggcgatctc
ggtgaccagtacaattccttcctcgacgtggaggaagttccggctggcggcggcgccaat
ggcgacgtcatcatcaaccgcgatggcaagctgttccggccgaagcggctcccgagcaac
ctcttccagttccgcaagggcacgggtgaggaccgctgcgtgctcgattcgatcacctcg
ctgcagaatggcgccgaccttctgtggatcgagaccgaaaagccgcatgtcgagcagatc
gccggcatgatggaccgcatccgcgccgtcatcccgaacgccaagctcgtctacaataat
tcgccctcgttcaactggacgatcaacttccgtcagcaagtctatgatgcctggaaggaa
gccggcaaggatgtttccgcctatgaccgcgctggcctgatggatgtgaaatatgacggc
agcgatcttgccgccgaggctgacgaaaaaatccgcaccttccaggccgacgcctcgaag
cgggcaggcattttccaccacctcatcaccctgccgacctatcacacggcggcgctgtcg
accgataaccttgccaaggaatatttcggcgaacaggggatgctcggctacgtgctgaat
gtccagcggcaagaaatccgccagaaaatcgcctgcgcgaagcaccagaacatggcgggt
tccgacattggcgacgatcacaaggaatatttcgctggcgaagccgcgttgaaggcgggc
ggcgccgacaacacgatgaaccagttcggctga

DBGET integrated database retrieval system