KEGG   Beijerinckia indica: Bind_0119Help
Entry
Bind_0119         CDS       T00688                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bid  Beijerinckia indica
Pathway
bid00010  Glycolysis / Gluconeogenesis
bid00020  Citrate cycle (TCA cycle)
bid00620  Pyruvate metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
bid01200  Carbon metabolism
Module
bid_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bind_0119
   00020 Citrate cycle (TCA cycle)
    Bind_0119
   00620 Pyruvate metabolism
    Bind_0119
Enzymes [BR:bid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bind_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 DUF676 Esterase Thioesterase Ndr Biotin_lipoyl_2 TusA Acyl_transf_1 Ser_hydrolase GCV_H
Motif
Other DBs
NCBI-ProteinID: ACB93777
JGI: Bind0119
UniProt: B2IBQ5
Position
complement(136076..137218)
Genome map
AA seq 380 aa AA seqDB search
MITGEIKAITMPKFGLAMTEGKVASWAKTIGAEVNVGDDLADIETTKITNAYESPVKGIL
RRQVAQEQEELPVGSLIAIIADRETSEDEIDRFIDKFQAEFVSEQDKSETVAAPEPRVIE
VSGQKIRILEIGNGEGAPIVFVHGFGGDLNNWMFNQPPLAEKHRTIAIDLPGHGGSVKET
SGDIASLAKSVGETLDALGVASAHFVGHSLGGAIILALALERPTLVASLSLISPAALGDV
INTDYTDGFITADRRKTLKPVLQLLFADPSLVSNDMIDDLIKFKRLDGATTALTAIASAN
FKEGRQSLNLLSRLAEIKAPVEILWGKQDQVVPMVDPGQLPGTIAFHPLEKSGHMPQMEQ
SAEVNGLIGDFITKVETKVG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccggagagatcaaagccatcaccatgccgaaattcggtctcgccatgaccgaa
ggcaaggtggcttcctgggcaaagaccatcggtgcggaagtcaatgtcggcgatgatctc
gccgacattgagacaaccaagatcaccaatgcctatgaaagcccggtcaaaggcattctg
cgccgccaggtcgcccaggaacaggaagaactgccggtcggctcgctgatcgctatcatc
gccgaccgcgagacatcggaagatgaaatcgatcggttcatcgataagttccaggccgaa
ttcgtcagtgaacaggacaaaagcgaaacggttgccgcccctgaacccagggtcatcgag
gtcagcggccagaaaatccgcattctcgaaatcggcaatggcgaaggcgcgccgatcgtc
ttcgtgcatggcttcggcggtgatctcaacaattggatgttcaatcagcctcccctcgct
gaaaagcacagaaccatcgcgattgacctgccaggccatggcggatccgtgaaagagact
tcgggcgatatcgcctcgctcgccaagagcgtgggcgaaaccctggatgcgctcggtgtt
gcttcagcgcatttcgtcggccattcgcttggcggcgcgatcattctcgccttggcgctc
gagcggccgacgcttgtcgcatcgctcagcctgatcagtccggcggccctcggcgatgtg
atcaacaccgattacaccgatggcttcatcacggccgaccgccgcaaaaccttgaagccg
gtgctacaattgctgttcgccgatccctccctcgtcagcaatgacatgatcgacgatctc
atcaagttcaaacgcctcgacggcgcgaccacggctttgaccgcgatcgctagcgccaat
ttcaaggagggacgccagagcctcaatctgctgtcgcgccttgccgaaatcaaagcgccg
gttgaaatcctctggggtaaacaggatcaggtcgtgccgatggttgatccaggccaactg
ccgggcaccatcgccttccatcctctcgagaagagcggacatatgccgcaaatggaacaa
tcggccgaggtcaacgggctgattggcgatttcatcacaaaggtcgagaccaaggtgggc
tga

DBGET integrated database retrieval system